Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.08
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
glioblastoma 5792 3.4e-06
ovarian cancer 8519 1.9e-04
medulloblastoma, large-cell 6241 5.3e-04
oligodendroglioma 2850 1.6e-03
osteosarcoma 7950 3.4e-03
ependymoma 4679 4.8e-03

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.200 4.8e-03
glioblastoma -1.200 3.4e-06
medulloblastoma, large-cell -1.100 5.3e-04
oligodendroglioma 1.200 1.6e-03
osteosarcoma 1.237 3.4e-03
ovarian cancer -1.400 1.9e-04

AA Sequence

MEKPAGRKKKTPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHVFDAFDASFKD      1 - 70
DFEGVPVFIPFQRKKPYECSECGRIFKHKTDHIRHQRVHTGEKPFKCAQCGKAFRHSSDVTKHQRTHTGE     71 - 140
KPFKCGECGKAFNCGSNLLKHQKTHTGEKPYECTHCGKAFAYSSCLIRHQKRHPRKKP                141 - 198
//

Text Mined References (5)

PMID Year Title