Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.13
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 0.000

AA Sequence

MLLKVRRASLKPPATPHQGAFRAGNVIGQLIYLLTWSLFTAWLRPPTLLQGPRTSPQGSPPRSPWGDCAE      1 - 70
PSCLCEMKIRRRRHEGPAWGQSGFLAGGLHLVPSSLSLAACGVVRMKGLWGRGAGIRGR                71 - 129
//

Text Mined References (1)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.