Property Summary

NCBI Gene PubMed Count 3
Grant Count 4
R01 Count 4
Funding $197,815.74
PubMed Score 2.42
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
20459687 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASEIHMPGPVCLTENTKGHLVVNSEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFPLGCT      1 - 70
VKSETKGIWMWCVPHPSKPNHTLILLDTEGLGDMEKSDPKSDSWIFALAVLLSSSFVYNSMGTINHQALE     71 - 140
QLHYVTELTELIRAKSCPRPDEVEDSSEFVSFFPDFIWTVRDFTLELKLDGHPITEDEYLENALKLISGK    141 - 210
NPQIQNSNKPREWIRHFFPKQKCFVFDRPINDKKLLLHVEEVREDQLDSNFQMQSENFCSYIFTHAKTKT    211 - 280
LREGILVTGNRLGMLVETYLDAINSGATPCLENAMAVLAQCENSAAVQRAANHYSQQMAQQVRFPTDTLQ    281 - 350
ELLDVHAVCEREAIAVFMEYSFKDKSQEFQKKLVDTMEKKKEDFVLQNEEASAKYCQAELKRLSELLTES    351 - 420
ISRGTFFVPGGHNIYLEAKKKIEQDYTLVPRKGVKADEVLQSFLQSQVVIEESILQSDKALTAGEKAIAA    421 - 490
KQAKKEAAEKEQELLRQKQKEQQQMMEAQERSFQENIAQLKKKMERERENYMRELRKMLSHKMKVLEELL    491 - 560
TEGFKEIFESLNEEINRLKEQIEAAENEEPSVFSQILDVAGSIFIAALPGAAKLVDLGMKILSSLCNRLR    561 - 630
NPGKKIIS                                                                  631 - 638
//

Text Mined References (4)

PMID Year Title
20459687 2010 Candidate malaria susceptibility/protective SNPs in hospital and population-based studies: the effect of sub-structuring.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16689661 2006 In silico genomic analysis of the human and murine guanylate-binding protein (GBP) gene clusters.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.