Property Summary

NCBI Gene PubMed Count 21
PubMed Score 317.66
PubTator Score 130.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.500 4.3e-03
astrocytic glioma -1.200 1.4e-02
atypical teratoid / rhabdoid tumor -2.700 7.8e-16
cystic fibrosis -2.438 1.3e-06
ependymoma -1.200 3.7e-02
glioblastoma -1.200 7.6e-03
group 3 medulloblastoma -1.700 1.1e-02
interstitial cystitis 1.200 7.6e-03
lung adenocarcinoma -1.100 9.5e-14
medulloblastoma, large-cell -2.700 6.6e-08
non-small cell lung carcinoma -1.100 2.9e-22
osteosarcoma -3.535 2.2e-07
primitive neuroectodermal tumor -1.500 2.6e-02
psoriasis 1.900 1.4e-32

Synonym

Accession Q8N8U9 A8K1P8 Q8TF36
Symbols CV2
CV-2
CRIM3

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (14)

AA Sequence

MLWFSGVGALAERYCRRSPGITCCVLLLLNCSGVPMSLASSFLTGSVAKCENEGEVLQIPFITDNPCIMC      1 - 70
VCLNKEVTCKREKCPVLSRDCALAIKQRGACCEQCKGCTYEGNTYNSSFKWQSPAEPCVLRQCQEGVVTE     71 - 140
SGVRCVVHCKNPLEHLGMCCPTCPGCVFEGVQYQEGEEFQPEGSKCTKCSCTGGRTQCVREVCPILSCPQ    141 - 210
HLSHIPPGQCCPKCLGQRKVFDLPFGSCLFRSDVYDNGSSFLYDNCTACTCRDSTVVCKRKCSHPGGCDQ    211 - 280
GQEGCCEECLLRVPPEDIKVCKFGNKIFQDGEMWSSINCTICACVKGRTECRNKQCIPISSCPQGKILNR    281 - 350
KGCCPICTEKPGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKS    351 - 420
VELVLGESRVSLQQHLTVRWNGSRIALPCRAPHFHIDLDGYLLKVTTKAGLEISWDGDSFVEVMAAPHLK    421 - 490
GKLCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTVKVKLRAHREC    491 - 560
QKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNCYCESFLAYTRACQREGIKVHWEPQQNCAATQCK    561 - 630
HGAVYDTCGPGCIKTCDNWNEIGPCNKPCVAGCHCPANLVLHKGRCIKPVLCPQR                   631 - 685
//

Text Mined References (21)

PMID Year Title