Property Summary

NCBI Gene PubMed Count 20
Grant Count 41
R01 Count 27
Funding $5,060,409.1
PubMed Score 302.54
PubTator Score 130.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.200 0.014
posterior fossa group A ependymoma -2.000 0.000
osteosarcoma -3.535 0.000
glioblastoma -1.700 0.009
medulloblastoma -2.600 0.000
cystic fibrosis -2.438 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.500 0.026
interstitial cystitis 1.200 0.008
lung adenocarcinoma -1.100 0.000
adult high grade glioma -1.500 0.004
non-small cell lung carcinoma -1.100 0.000
psoriasis 1.900 0.000

Gene RIF (13)

PMID Text
26467725 BMPER variants associated with a novel, attenuated subtype of diaphanospondylodysostosis.
26264461 BMPER-dependent pathway involved in high glucose induced alkaline phosphatase expression in vascular smooth muscle cells.
25503991 The proangiogenic BMPER effect in endothelial cells is mediated by inhibition of antiangiogenic thrombospondin-1 and enhanced expression and activation of the FGF signaling pathway that is crucial in the promotion of angiogenesis.
23641068 these results suggest that BMPER and Tsg maintain a fine-tuned equilibrium that controls BMP pathway activity and is necessary for vascular cell homeostasis.
22778264 BMPER is a novel regulator of the osteoblast-like differentiation of HCASMCs.
22772758 Bmper is a critical regulator of Bmp-mediated vascular inflammation and that the fine-tuning of Bmp and Bmper levels is essential in the maintenance of normal vascular homeostasis.
22474252 Mutual regulation by BMP-9 and CV2 is essential in regulating the development of the vascular endothelium.
22020334 The data unequivocally demonstrated that BMPER is highly expressed in malignant tumors and that the growth of lung, colon, and uterine carcinomas is dependent on the presence of BMPER.
21990102 Diaphonospondylodysostosis is caused by loss of BMPER function.
20869035 BMPER-mediated signaling plays an essential role in vertebral segmentation early in human development, while defects in BMPER produce Diaphanospondylodysostosis.
More...

AA Sequence

MLWFSGVGALAERYCRRSPGITCCVLLLLNCSGVPMSLASSFLTGSVAKCENEGEVLQIPFITDNPCIMC      1 - 70
VCLNKEVTCKREKCPVLSRDCALAIKQRGACCEQCKGCTYEGNTYNSSFKWQSPAEPCVLRQCQEGVVTE     71 - 140
SGVRCVVHCKNPLEHLGMCCPTCPGCVFEGVQYQEGEEFQPEGSKCTKCSCTGGRTQCVREVCPILSCPQ    141 - 210
HLSHIPPGQCCPKCLGQRKVFDLPFGSCLFRSDVYDNGSSFLYDNCTACTCRDSTVVCKRKCSHPGGCDQ    211 - 280
GQEGCCEECLLRVPPEDIKVCKFGNKIFQDGEMWSSINCTICACVKGRTECRNKQCIPISSCPQGKILNR    281 - 350
KGCCPICTEKPGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKS    351 - 420
VELVLGESRVSLQQHLTVRWNGSRIALPCRAPHFHIDLDGYLLKVTTKAGLEISWDGDSFVEVMAAPHLK    421 - 490
GKLCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTVKVKLRAHREC    491 - 560
QKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNCYCESFLAYTRACQREGIKVHWEPQQNCAATQCK    561 - 630
HGAVYDTCGPGCIKTCDNWNEIGPCNKPCVAGCHCPANLVLHKGRCIKPVLCPQR                   631 - 685
//

Text Mined References (20)

PMID Year Title
26467725 2015 BMPER variants associated with a novel, attenuated subtype of diaphanospondylodysostosis.
26264461 2015 Involvement of Rho-associated protein kinase (ROCK) and bone morphogenetic protein-binding endothelial cell precursor-derived regulator (BMPER) in high glucose-increased alkaline phosphatase expression and activity in human coronary artery smooth muscle cells.
25503991 2015 Fibroblast growth factor signaling pathway in endothelial cells is activated by BMPER to promote angiogenesis.
24770881 2014 ABCC9 gene polymorphism is associated with hippocampal sclerosis of aging pathology.
23641068 2013 Antagonism and synergy between extracellular BMP modulators Tsg and BMPER balance blood vessel formation.
22778264 2012 Osteoblast-like differentiation of cultured human coronary artery smooth muscle cells by bone morphogenetic protein endothelial cell precursor-derived regulator (BMPER).
22772758 2012 Bmper inhibits endothelial expression of inflammatory adhesion molecules and protects against atherosclerosis.
22474252 2012 Crossveinless 2 regulates bone morphogenetic protein 9 in human and mouse vascular endothelium.
22020334 2012 Bone morphogenetic protein modulator BMPER is highly expressed in malignant tumors and controls invasive cell behavior.
21990102 2011 A deleterious founder mutation in the BMPER gene causes diaphanospondylodysostosis (DSD).
More...