Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
R01 Count 5
Funding $1,631,227
PubMed Score 10.64
PubTator Score 1.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.400 0.003
ependymoma -2.200 0.000
oligodendroglioma -1.500 0.006
glioblastoma -2.500 0.000
osteosarcoma 1.359 0.000
sonic hedgehog group medulloblastoma -2.800 0.000
cystic fibrosis 1.309 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -4.100 0.000
primitive neuroectodermal tumor -2.400 0.000
adult high grade glioma -2.300 0.000
pilocytic astrocytoma -2.000 0.000
subependymal giant cell astrocytoma -2.611 0.001
ductal carcinoma in situ 1.300 0.048
invasive ductal carcinoma 1.800 0.005
ulcerative colitis 1.200 0.000
ovarian cancer 1.600 0.000
pituitary cancer 1.100 0.037

Gene RIF (5)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19844255 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASGDLYEVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHMSKDKRIKSGK      1 - 70
QSSTSKLLRDSRGPSVEKLSHRPSDPGKSKGTSHKRKRINPPLAKPKKGYSGKPSSGGDRATKTVSYRTT     71 - 140
PSGLQIMPLKKSQNGMENGDAGSEKDERHFGNGSHQPGLDLNDHVGEQDMGECDVNHATLAENGLGSALT    141 - 210
NGGLNLHSPVKRKLEAEKDYVFDKRLRYSVRQNESNCRFRDIVVRKEEGFTHILLSSQTSDNNALTPEIM    211 - 280
KEVRRALCNAATDDSKLLLLSAVGSVFCSGLDYSYLIGRLSSDRRKESTRIAEAIRDFVKAFIQFKKPIV    281 - 350
VAINGPALGLGASILPLCDIVWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVALANEMLFCGRKLTAQ    351 - 420
EACSRGLVSQVFWPTTFSQEVMLRVKEMASCSAVVLEESKCLVRSFLKSVLEDVNEKECLMLKQLWSSSK    421 - 490
GLDSLFSYLQDKIYEV                                                          491 - 506
//

Text Mined References (15)

PMID Year Title
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...