Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.64
PubTator Score 1.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.300 2.4e-05
astrocytic glioma -1.400 3.0e-03
Astrocytoma, Pilocytic -2.000 2.1e-09
atypical teratoid / rhabdoid tumor -2.700 1.1e-09
cystic fibrosis 1.309 4.5e-04
ductal carcinoma in situ 1.300 4.8e-02
ependymoma -1.900 1.6e-03
glioblastoma -2.000 2.8e-09
group 3 medulloblastoma -2.300 1.5e-04
invasive ductal carcinoma 1.800 4.6e-03
medulloblastoma, large-cell 1.100 4.9e-04
oligodendroglioma -1.500 5.7e-03
osteosarcoma 1.359 7.7e-07
ovarian cancer 1.600 1.1e-11
pituitary cancer 1.100 3.7e-02
primitive neuroectodermal tumor -2.400 4.8e-04
subependymal giant cell astrocytoma -2.611 1.2e-03
ulcerative colitis 1.200 2.1e-04

Synonym

Accession Q8N8U2 Q7Z5I8 CDY-like 2
Symbols PCCP1

Gene

PDB

2MJ8   4HAE   5JJZ  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (5)

AA Sequence

MASGDLYEVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHMSKDKRIKSGK      1 - 70
QSSTSKLLRDSRGPSVEKLSHRPSDPGKSKGTSHKRKRINPPLAKPKKGYSGKPSSGGDRATKTVSYRTT     71 - 140
PSGLQIMPLKKSQNGMENGDAGSEKDERHFGNGSHQPGLDLNDHVGEQDMGECDVNHATLAENGLGSALT    141 - 210
NGGLNLHSPVKRKLEAEKDYVFDKRLRYSVRQNESNCRFRDIVVRKEEGFTHILLSSQTSDNNALTPEIM    211 - 280
KEVRRALCNAATDDSKLLLLSAVGSVFCSGLDYSYLIGRLSSDRRKESTRIAEAIRDFVKAFIQFKKPIV    281 - 350
VAINGPALGLGASILPLCDIVWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVALANEMLFCGRKLTAQ    351 - 420
EACSRGLVSQVFWPTTFSQEVMLRVKEMASCSAVVLEESKCLVRSFLKSVLEDVNEKECLMLKQLWSSSK    421 - 490
GLDSLFSYLQDKIYEV                                                          491 - 506
//

Text Mined References (15)

PMID Year Title