Tbio | Protein enabled homolog |
Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance and lamellipodial and filopodial dynamics in migrating cells. ENAH induces the formation of F-actin rich outgrowths in fibroblasts. Acts synergistically with BAIAP2-alpha and downstream of NTN1 to promote filipodia formation (By similarity).
This gene encodes a member of the enabled/ vasodilator-stimulated phosphoprotein. Members of this gene family are involved in actin-based motility. This protein is involved in regulating the assembly of actin filaments and modulates cell adhesion and motility. Alternate splice variants of this gene have been correlated with tumor invasiveness in certain tissues and these variants may serve as prognostic markers. A pseudogene of this gene is found on chromosome 3. [provided by RefSeq, Sep 2016]
This gene encodes a member of the enabled/ vasodilator-stimulated phosphoprotein. Members of this gene family are involved in actin-based motility. This protein is involved in regulating the assembly of actin filaments and modulates cell adhesion and motility. Alternate splice variants of this gene have been correlated with tumor invasiveness in certain tissues and these variants may serve as prognostic markers. A pseudogene of this gene is found on chromosome 3. [provided by RefSeq, Sep 2016]
Comments
Disease | Target Count |
---|---|
IGA Glomerulonephritis | 454 |
Leukemia, Myelocytic, Acute | 113 |
Disease | log2 FC | p |
---|---|---|
interstitial lung disease | 1.200 | 0.045 |
astrocytoma | 1.300 | 0.000 |
glioblastoma | 1.500 | 0.000 |
oligodendroglioma | 1.200 | 0.000 |
osteosarcoma | 1.797 | 0.001 |
posterior fossa group A ependymoma | 1.500 | 0.000 |
group 3 medulloblastoma | 1.800 | 0.000 |
cystic fibrosis | -1.907 | 0.000 |
atypical teratoid/rhabdoid tumor | 1.600 | 0.000 |
medulloblastoma, large-cell | 1.300 | 0.000 |
primitive neuroectodermal tumor | 1.100 | 0.001 |
hereditary spastic paraplegia | -1.580 | 0.010 |
juvenile dermatomyositis | 1.243 | 0.000 |
non-small cell lung cancer | 1.304 | 0.000 |
lung cancer | 1.100 | 0.014 |
active Crohn's disease | 1.022 | 0.011 |
pediatric high grade glioma | 1.500 | 0.000 |
pilocytic astrocytoma | 1.300 | 0.000 |
subependymal giant cell astrocytoma | 2.392 | 0.005 |
ductal carcinoma in situ | 1.800 | 0.000 |
invasive ductal carcinoma | 1.500 | 0.004 |
ovarian cancer | 1.500 | 0.012 |
Breast cancer | 1.300 | 0.000 |
PMID | Text |
---|---|
26956036 | PPARgamma might inhibit the proliferation and migration of GC cell lines through suppressing the expression of TERT and ENAH |
26680363 | these data provide the first description of endogenous Mena(INV) protein expression in mouse and human breast tumors. |
26112005 | we evaluate the prognostic value of Menacalc in a cohort of ANN patients. Our primary objective was to determine if there was an association between Menacalc and overall patient mortality. |
25961924 | our results indicate that hMENA11a is an anti-apoptotic regulator involved in the HER3-mediated mechanisms of resistance to PI3K inhibition in breast cancer |
25449779 | High ENAH expression is associated with trastuzumab-resistant breast cancer. |
25429076 | Invasive breast ductal-carcinoma cells that migrated thru a layer of human endothelial cells were enriched for the transcript encoding Mena(INV), an invasive isoform of Mena. |
25109497 | the higher relative expression of hMena(11a) compared with hMena(INV) may predict malignant transformation in breast epithelial cells, and, furthermore, a reversal of expression of hMena(11a) and hMena(INV) may dictate the state of cancer progression |
25031323 | determined the alpha-synuclein-binding domain of beta-III tubulin and demonstrated that a short fragment containing this domain can suppress alpha-synuclein accumulation in the primary cultured cells |
24683008 | High expression of Mena is associated with hepatocellular carcinoma. |
24076656 | this study suggests a novel mechanism in which Lpd mediates EGFR endocytosis via Mena downstream of endophilin. |
More... |
MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKY 1 - 70 NQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEEL 71 - 140 EIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERL 141 - 210 ERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSV 211 - 280 LGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP 281 - 350 PPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIG 351 - 420 VNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTP 421 - 490 EPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQ 491 - 560 DILDEMRKELTKLKEELIDAIRQELSKSNTA 561 - 591 //
PMID | Year | Title |
---|---|---|
26956036 | 2016 | Constitutive expression of PPAR? inhibits proliferation and migration of gastric cancer cells and down-regulates Wnt/?-Catenin signaling pathway downstream target genes TERT and ENAH. |
26680363 | 2016 | Characterization of the expression of the pro-metastatic Mena(INV) isoform during breast tumor progression. |
26112005 | 2015 | Menacalc, a quantitative method of metastasis assessment, as a prognostic marker for axillary node-negative breast cancer. |
25961924 | 2016 | hMENA(11a) contributes to HER3-mediated resistance to PI3K inhibitors in HER2-overexpressing breast cancer cells. |
25449779 | 2015 | A pathway-based approach for identifying biomarkers of tumor progression to trastuzumab-resistant breast cancer. |
25429076 | 2014 | Invasive breast carcinoma cells from patients exhibit MenaINV- and macrophage-dependent transendothelial migration. |
25109497 | 2014 | Relative expression of hMena11a and hMenaINV splice isoforms is a useful biomarker in development and progression of human breast carcinoma. |
25031323 | 2014 | Dynamin1 is a novel target for IRSp53 protein and works with mammalian enabled (Mena) protein and Eps8 to regulate filopodial dynamics. |
24683008 | 2014 | Expression of cytoskeleton regulatory protein Mena in human hepatocellular carcinoma and its prognostic significance. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
More... |