Property Summary

NCBI Gene PubMed Count 68
Grant Count 13
R01 Count 11
Funding $539,194.68
PubMed Score 9.05
PubTator Score 302.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

PMID Text
26956036 PPARgamma might inhibit the proliferation and migration of GC cell lines through suppressing the expression of TERT and ENAH
26680363 these data provide the first description of endogenous Mena(INV) protein expression in mouse and human breast tumors.
26112005 we evaluate the prognostic value of Menacalc in a cohort of ANN patients. Our primary objective was to determine if there was an association between Menacalc and overall patient mortality.
25961924 our results indicate that hMENA11a is an anti-apoptotic regulator involved in the HER3-mediated mechanisms of resistance to PI3K inhibition in breast cancer
25449779 High ENAH expression is associated with trastuzumab-resistant breast cancer.
25429076 Invasive breast ductal-carcinoma cells that migrated thru a layer of human endothelial cells were enriched for the transcript encoding Mena(INV), an invasive isoform of Mena.
25109497 the higher relative expression of hMena(11a) compared with hMena(INV) may predict malignant transformation in breast epithelial cells, and, furthermore, a reversal of expression of hMena(11a) and hMena(INV) may dictate the state of cancer progression
25031323 determined the alpha-synuclein-binding domain of beta-III tubulin and demonstrated that a short fragment containing this domain can suppress alpha-synuclein accumulation in the primary cultured cells
24683008 High expression of Mena is associated with hepatocellular carcinoma.
24076656 this study suggests a novel mechanism in which Lpd mediates EGFR endocytosis via Mena downstream of endophilin.
More...

AA Sequence

MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKY      1 - 70
NQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEEL     71 - 140
EIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERL    141 - 210
ERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSV    211 - 280
LGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP    281 - 350
PPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIG    351 - 420
VNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTP    421 - 490
EPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQ    491 - 560
DILDEMRKELTKLKEELIDAIRQELSKSNTA                                           561 - 591
//

Text Mined References (76)

PMID Year Title
26956036 2016 Constitutive expression of PPAR? inhibits proliferation and migration of gastric cancer cells and down-regulates Wnt/?-Catenin signaling pathway downstream target genes TERT and ENAH.
26680363 2016 Characterization of the expression of the pro-metastatic Mena(INV) isoform during breast tumor progression.
26112005 2015 Menacalc, a quantitative method of metastasis assessment, as a prognostic marker for axillary node-negative breast cancer.
25961924 2016 hMENA(11a) contributes to HER3-mediated resistance to PI3K inhibitors in HER2-overexpressing breast cancer cells.
25449779 2015 A pathway-based approach for identifying biomarkers of tumor progression to trastuzumab-resistant breast cancer.
25429076 2014 Invasive breast carcinoma cells from patients exhibit MenaINV- and macrophage-dependent transendothelial migration.
25109497 2014 Relative expression of hMena11a and hMenaINV splice isoforms is a useful biomarker in development and progression of human breast carcinoma.
25031323 2014 Dynamin1 is a novel target for IRSp53 protein and works with mammalian enabled (Mena) protein and Eps8 to regulate filopodial dynamics.
24683008 2014 Expression of cytoskeleton regulatory protein Mena in human hepatocellular carcinoma and its prognostic significance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...