Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.25
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Disease Target Count P-value
ovarian cancer 8519 2.5e-07

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.800 2.5e-07

Synonym

Accession Q8N8R7 Q5HYH9
Symbols ARF7EP
C11orf46
dJ299F11.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MMDPCSVGVQLRTTNECHKTYYTRHTGFKTLQELSSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFED      1 - 70
LQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPE     71 - 140
SDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRLTKNATAGSDRQVIPAKSKVYDSQGLLIFSGMDLCD    141 - 210
CLDEDCLGCFYACPACGSTKCGAECRCDRKWLYEQIEIEGGEIIHNKHAG                        211 - 260
//

Text Mined References (11)

PMID Year Title