Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 4.7e-02
atypical teratoid / rhabdoid tumor -1.200 3.8e-06
fascioscapulohumeral muscular dystrophy 1.166 3.6e-05
medulloblastoma, large-cell -1.600 1.1e-04
osteosarcoma -1.579 3.7e-03

AA Sequence

MWGFRLLRSPPLLLLLPQLGIGNASSCSQARTMNPGGSGGARCSLSAEVRRRQCLQLSTVPGADPQRSNE      1 - 70
LLLLAAAGEGLERQDLPGDPAKEEPQPPPQHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAH     71 - 140
RFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEHNTDFGAFKHLYMLLVNAFNLSQNSLSKKSLNVW    141 - 210
NKDSIASNCRSSPSHTTNGCQGEKVRTCEKSDESAMSFYPPSLNDASFTLIGFSKGCVVLNQLLFELKEA    211 - 280
KKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLKEFAQTGIIVHTHVTPYQVRDPMRSWIGKEHKK    281 - 350
FVQILGDLGMQVTSQIHFTKEAPSIENHFRVHEVF                                       351 - 385
//

Text Mined References (8)

PMID Year Title