Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.7824751440727E-6
fascioscapulohumeral muscular dystrophy 100 3.64668043565277E-5
medulloblastoma, large-cell 6234 1.06362757615049E-4
osteosarcoma 7933 0.00371264798058504
astrocytic glioma 2241 0.0468989278740227
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 0.047
osteosarcoma -1.579 0.004
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.600 0.000
fascioscapulohumeral muscular dystrophy 1.166 0.000

Synonym

Accession Q8N8R5 Q8NE30
Symbols

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

AA Sequence

MWGFRLLRSPPLLLLLPQLGIGNASSCSQARTMNPGGSGGARCSLSAEVRRRQCLQLSTVPGADPQRSNE      1 - 70
LLLLAAAGEGLERQDLPGDPAKEEPQPPPQHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAH     71 - 140
RFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEHNTDFGAFKHLYMLLVNAFNLSQNSLSKKSLNVW    141 - 210
NKDSIASNCRSSPSHTTNGCQGEKVRTCEKSDESAMSFYPPSLNDASFTLIGFSKGCVVLNQLLFELKEA    211 - 280
KKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLKEFAQTGIIVHTHVTPYQVRDPMRSWIGKEHKK    281 - 350
FVQILGDLGMQVTSQIHFTKEAPSIENHFRVHEVF                                       351 - 385
//

Text Mined References (8)

PMID Year Title
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.