Property Summary

NCBI Gene PubMed Count 7
PubMed Score 33.82
PubTator Score 9.80

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
active ulcerative colitis 1.002 2.1e-02
ependymoma 1.200 1.5e-02
intraductal papillary-mucinous carcinoma... 1.100 6.0e-03
intraductal papillary-mucinous neoplasm ... 1.400 4.4e-03
osteosarcoma 1.112 3.0e-06

Gene RIF (4)

AA Sequence

MALDFLAGCAGGVAGVLVGHPFDTVKVRLQVQSVEKPQYRGTLHCFKSIIKQESVLGLYKGLGSPLMGLT      1 - 70
FINALVFGVQGNTLRALGHDSPLNQFLAGAAAGAIQCVICCPMELAKTRLQLQDAGPARTYKGSLDCLAQ     71 - 140
IYGHEGLRGVNRGMVSTLLRETPSFGVYFLTYDALTRALGCEPGDRLLVPKLLLAGGTSGIVSWLSTYPV    141 - 210
DVVKSRLQADGLRGAPRYRGILDCVHQSYRAEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEE    211 - 280
AGPEGEAVPAAPAGPALAQPSSL                                                   281 - 303
//

Text Mined References (10)

PMID Year Title