Property Summary

NCBI Gene PubMed Count 7
Grant Count 3
R01 Count 3
Funding $1,281,826
PubMed Score 31.89
PubTator Score 9.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Synonym

Accession Q8N8R3 A3KMR5 Q541V0
Symbols CACL
ORNT3
C14orf69

Gene

Gene RIF (4)

PMID Text
24652292 The main physiological role of SLC25A29 is to import basic amino acids into mitochondria for mitochondrial protein synthesis and amino acid degradation.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19287344 The human and mouse SLC25A29 mitochondrial ornithine transporters (designated as ORNT3) rescue the deficient ornithine metabolism in fibroblasts of patients with the hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome.

AA Sequence

MALDFLAGCAGGVAGVLVGHPFDTVKVRLQVQSVEKPQYRGTLHCFKSIIKQESVLGLYKGLGSPLMGLT      1 - 70
FINALVFGVQGNTLRALGHDSPLNQFLAGAAAGAIQCVICCPMELAKTRLQLQDAGPARTYKGSLDCLAQ     71 - 140
IYGHEGLRGVNRGMVSTLLRETPSFGVYFLTYDALTRALGCEPGDRLLVPKLLLAGGTSGIVSWLSTYPV    141 - 210
DVVKSRLQADGLRGAPRYRGILDCVHQSYRAEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEE    211 - 280
AGPEGEAVPAAPAGPALAQPSSL                                                   281 - 303
//

Text Mined References (10)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24652292 2014 The human gene SLC25A29, of solute carrier family 25, encodes a mitochondrial transporter of basic amino acids.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19287344 2009 The human and mouse SLC25A29 mitochondrial transporters rescue the deficient ornithine metabolism in fibroblasts of patients with the hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12882971 2003 A novel mitochondrial carnitine-acylcarnitine translocase induced by partial hepatectomy and fasting.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.