Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.46
PubTator Score 4.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Kidney disease 430 0.0 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 3.2e-02
group 3 medulloblastoma 1.100 2.1e-03
osteosarcoma -1.505 1.7e-05
ovarian cancer -1.400 2.4e-04
pancreatic ductal adenocarcinoma liver m... -1.441 1.2e-02
Pick disease -1.200 2.0e-06

Gene RIF (8)

AA Sequence

MLCRLGGRWLRPLPALQLWARDLPLAPVPTSGAKRPTLPVWAVAPVSAVHANGWYEALAASSPVRVAEEV      1 - 70
LLGVHAATGLPWWGSILLSTVALRGAVTLPLAAYQHYILAKVENLQPEIKTIARHLNQEVAVRANQLGWS     71 - 140
KRDARLTYLKNMRRLISELYVRDNCHPFKATVLVWIQLPMWIFMSFALRNLSTGAAHSEGFSVQEQLATG    141 - 210
GILWFPDLTAPDSTWILPISVGVINLLIVEICALQKIGMSRFQTYITYFVRAMSVLMIPIAATVPSSIVL    211 - 280
YWLCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISRK                     281 - 333
//

Text Mined References (14)

PMID Year Title