Property Summary

NCBI Gene PubMed Count 13
Grant Count 11
R01 Count 11
Funding $590,588.12
PubMed Score 5.03
PubTator Score 4.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 0.032
osteosarcoma -1.505 0.000
pancreatic ductal adenocarcinoma liver m... -1.441 0.012
group 3 medulloblastoma 1.100 0.002
Pick disease -1.200 0.000
ovarian cancer -1.400 0.000

Gene RIF (7)

PMID Text
22082156 Knockdown of COX18 cytochrome c oxidase assembly homolog (S. cerevisiae) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20877624 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200953 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19373256 COX18 mutations may be very rare or associated with other phenotypes than isolated COX deficiency in infancy.
16212937 Both hCox18p and hCox19p present significant amino acid identity with the corresponding yeast polypeptides and reveal highly conserved functional domains.

AA Sequence

MLCRLGGRWLRPLPALQLWARDLPLAPVPTSGAKRPTLPVWAVAPVSAVHANGWYEALAASSPVRVAEEV      1 - 70
LLGVHAATGLPWWGSILLSTVALRGAVTLPLAAYQHYILAKVENLQPEIKTIARHLNQEVAVRANQLGWS     71 - 140
KRDARLTYLKNMRRLISELYVRDNCHPFKATVLVWIQLPMWIFMSFALRNLSTGAAHSEGFSVQEQLATG    141 - 210
GILWFPDLTAPDSTWILPISVGVINLLIVEICALQKIGMSRFQTYITYFVRAMSVLMIPIAATVPSSIVL    211 - 280
YWLCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISRK                     281 - 333
//

Text Mined References (13)

PMID Year Title
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20200953 2010 Genome-wide pleiotropy of osteoporosis-related phenotypes: the Framingham Study.
19373256 2009 Mutation analysis of COX18 in 29 patients with isolated cytochrome c oxidase deficiency.
16911509 2006 The COX18 gene, involved in mitochondrial biogenesis, is functionally conserved and tightly regulated in humans and fission yeast.
16212937 2005 hCOX18 and hCOX19: two human genes involved in cytochrome c oxidase assembly.
More...