Property Summary

NCBI Gene PubMed Count 11
PubMed Score 181.39
PubTator Score 39.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 6.71112680962501E-5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.186 0.000

Synonym

Accession Q8N8Q3 I3L3S4 Q6P2G2 Q86X99 Q8NAK0 hEndoV
Symbols

Gene

PDB

4NSP  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
25824682 Human EndoV appears inactive on DNA, but has been shown to incise various RNA substrates containing inosine. [review]
25053281 ENDOV was significantly associated with schizophrenia.
23912718 hEndoV controls the fate of inosine-containing RNA in humans.
23912683 This previously unknown RNA incision activity may suggest a role for endonuclease V in normal RNA metabolism.
23139746 ENDOV is localized in the cytoplasm and nucleoli of human cells.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MALEAAGGPPEETLSLWKREQARLKAHVVDRDTEAWQRDPAFSGLQRVGGVDVSFVKGDSVRACASLVVL      1 - 70
SFPELEVVYEESRMVSLTAPYVSGFLAFREVPFLLELVQQLREKEPGLMPQVLLVDGNGVLHHRGFGVAC     71 - 140
HLGVLTDLPCVGVAKKLLQVDGLENNALHKEKIRLLQTRGDSFPLLGDSGTVLGMALRSHDRSTRPLYIS    141 - 210
VGHRMSLEAAVRLTCCCCRFRIPEPVRQADICSREHIRKSLGLPGPPTPRSPKAQRPVACPKGDSGESSA    211 - 280
LC                                                                        281 - 282
//

Text Mined References (14)

PMID Year Title
25824682 2015 Structural basis for incision at deaminated adenines in DNA and RNA by endonuclease V.
25053281 2015 Analysis of t(9;17)(q33.2;q25.3) chromosomal breakpoint regions and genetic association reveals novel candidate genes for bipolar disorder.
23912718 2013 Human endonuclease V is a ribonuclease specific for inosine-containing RNA.
23912683 2013 Endonuclease V cleaves at inosines in RNA.
23139746 2012 The human homolog of Escherichia coli endonuclease V is a nucleolar protein with affinity for branched DNA structures.
22664237 2012 Human endonuclease V as a repair enzyme for DNA deamination.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...