Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.2e-08
primary pancreatic ductal adenocarcinoma 1109 2.0e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.067 1.2e-08
primary pancreatic ductal adenocarcinoma -1.097 2.0e-03

AA Sequence

MQPLEVGLVPAPAGEPRLTRWLRRGSGILAHLVALGFTIFLTALSRPGTSLFSWHPVFMALAFCLCMAEA      1 - 70
ILLFSPEHSLFFFCSRKARIRLHWAGQTLAILCAALGLGFIISSRTRSELPHLVSWHSWVGALTLLATAV     71 - 140
QALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVTVLLGMYSVWFQAQIKGAAWYLCLALPVYPA    141 - 210
LVIMHQISRSYLPRKKMEM                                                       211 - 229
//

Text Mined References (9)

PMID Year Title