Knowledge Summary

Patent

No data available

Synonym

Accession Q8N8P6
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MVDGRTRTIINDIFFTEPTPEMSSLPVRSHSSLSLNLVSLMVICRGIIKLVIHFRMYCPPRLKAKHIEPT      1 - 70
LRPVPLKELRISHWPNECIRHSASVPMATGANGLETKDETKRNAEKCACSVFL                      71 - 123
//

Text Mined References (2)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.