Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.50
PubTator Score 7.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 1.700 0.000
cystic fibrosis 1.052 0.000

Gene RIF (5)

PMID Text
26820738 Silencing of PTGR2 expression enhances reactive oxygen species production, suppresses pancreatic cell proliferation, and promotes cell death through increasing 15-keto-PGE2.
22998775 Functional data and clinical relevance for the role of PTGR2 in gastric cancer, are provided.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19000823 Besides targeting cyclooxygenase, indomethacin inhibits PTGR2 with a binding mode similar to that of 15-keto-PGE(2).
15004468 Cloning and tissue distribution of a splicing variant ZADH1b.

AA Sequence

MIVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWQL      1 - 70
SQVVDGGGIGIIEESKHTNLTKGDFVTSFYWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTS     71 - 140
LIGIQEKGHITAGSNKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSELGFDAAINYKK    141 - 210
DNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSPAIEAIQKER    211 - 280
NITRERFLVLNYKDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEEIS    281 - 350
L//

Text Mined References (17)

PMID Year Title
26820738 2016 Inhibition of Prostaglandin Reductase 2, a Putative Oncogene Overexpressed in Human Pancreatic Adenocarcinoma, Induces Oxidative Stress-Mediated Cell Death Involving xCT and CTH Gene Expressions through 15-Keto-PGE2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22998775 2012 Prostaglandin reductase 2 modulates ROS-mediated cell death and tumor transformation of gastric cancer cells and is associated with higher mortality in gastric cancer patients.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19000823 2008 Structural basis for catalytic and inhibitory mechanisms of human prostaglandin reductase PTGR2.
18497997 2008 Genomic analyses identify gene candidates for acquired irinotecan resistance in melanoma cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17449869 2007 Identification of a novel prostaglandin reductase reveals the involvement of prostaglandin E2 catabolism in regulation of peroxisome proliferator-activated receptor gamma activation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15004468 2003 Cloning and characterization of a novel splicing variant of the ZADH1 gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.