Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.94
PubTator Score 7.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 6.3e-07
cystic fibrosis 1696 4.3e-04
Disease Target Count Z-score Confidence
Rabies 20 3.073 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
cystic fibrosis 1.052 4.3e-04
ependymoma 1.600 6.3e-07

Gene RIF (5)

AA Sequence

MIVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWQL      1 - 70
SQVVDGGGIGIIEESKHTNLTKGDFVTSFYWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTS     71 - 140
LIGIQEKGHITAGSNKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSELGFDAAINYKK    141 - 210
DNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSPAIEAIQKER    211 - 280
NITRERFLVLNYKDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEEIS    281 - 350
L//

Text Mined References (17)

PMID Year Title