Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.91
PubTator Score 2.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Breast cancer 3,094

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 2.400 0.048

Synonym

Accession Q8N8N0 B3KV99 Q52LA4
Symbols

Gene

Gene RIF (3)

PMID Text
25936802 A mechanism for regulation of mTORC1 signaling by RNF152-mediated K63-linked polyubiquitination of RagA.
21203937 RNF152 is a lysosome localized E3 ligase with pro-apoptotic activities
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKLPPGFSVSQLP      1 - 70
DDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERALLPGDMGCRLLPGSQQKSVTVVTIPAEQQ     71 - 140
PLQGGAPQEAVEEEQDRRGVVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG           141 - 203
//

Text Mined References (7)

PMID Year Title
25936802 2015 The ubiquitination of rag A GTPase by RNF152 negatively regulates mTORC1 activation.
21203937 2010 RNF152, a novel lysosome localized E3 ligase with pro-apoptotic activities.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.