Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.96
PubTator Score 2.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 2.400 4.8e-02

Gene RIF (3)

AA Sequence

METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKLPPGFSVSQLP      1 - 70
DDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERALLPGDMGCRLLPGSQQKSVTVVTIPAEQQ     71 - 140
PLQGGAPQEAVEEEQDRRGVVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG           141 - 203
//

Text Mined References (7)

PMID Year Title