Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.91
PubTator Score 2.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 0.0480707466439817

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 2.400 0.048

Synonym

Accession Q8N8N0 B3KV99 Q52LA4
Symbols

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (3)

PMID Text
25936802 A mechanism for regulation of mTORC1 signaling by RNF152-mediated K63-linked polyubiquitination of RagA.
21203937 RNF152 is a lysosome localized E3 ligase with pro-apoptotic activities
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKLPPGFSVSQLP      1 - 70
DDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERALLPGDMGCRLLPGSQQKSVTVVTIPAEQQ     71 - 140
PLQGGAPQEAVEEEQDRRGVVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG           141 - 203
//

Text Mined References (7)

PMID Year Title
25936802 2015 The ubiquitination of rag A GTPase by RNF152 negatively regulates mTORC1 activation.
21203937 2010 RNF152, a novel lysosome localized E3 ligase with pro-apoptotic activities.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.