Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 2.49946578655011E-5
ovarian cancer 8492 4.64666713506235E-4
gastric cancer 436 0.00197300204942976
group 3 medulloblastoma 2254 0.00285332000666913
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0252240101173381

Expression

  Differential Expression (5)

Disease log2 FC p
gastric cancer 1.100 0.002
intraductal papillary-mucinous carcinoma... -1.300 0.025
group 3 medulloblastoma 1.500 0.003
Breast cancer -1.200 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q8N8L6
Symbols ARL10A

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAEAARLPEWDEWDPEDEEDEEP      1 - 70
ALEELEQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWK     71 - 140
EFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVVVVANKQDLSEAMSMGELQRELGLQAIDNQ    141 - 210
REVFLLAASIAPAGPTFEEPGTVHIWKLLLELLS                                        211 - 244
//

Text Mined References (3)

PMID Year Title
15033445 2004 RASL11A, member of a novel small monomeric GTPase gene family, is down-regulated in prostate tumors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.