ADP-ribosylation factor-like protein 10

Property Summary

NCBI Gene PubMed Count	3
PubMed Score	0.14

PubTator Score	0.83

Knowledge Summary

Patent

No data available

TINX Plot

Disease (1)

Expression Atlas

Disease	Target Count	P-value
Breast cancer	3578	2.5e-05
ovarian cancer	8520	4.6e-04
gastric cancer	459	2.0e-03
group 3 medulloblastoma	4104	2.9e-03
intraductal papillary-mucinous carcinoma (IPMC)	2989	2.5e-02

Differential Expression (5)

Disease	log2 FC	p
Breast cancer	-1.200	2.5e-05
gastric cancer	1.100	2.0e-03
group 3 medulloblastoma	1.500	2.9e-03
intraductal papillary-mucinous carcinoma...	-1.300	2.5e-02
ovarian cancer	-1.200	4.6e-04

Ovary 17,971

Nerve - Tibial 18,007

Uterus 17,618

Vagina 17,834

Colon - Sigmoid 18,089

Artery - Coronary 17,949

Artery - Aorta 17,896

Brain - Cerebellum 17,983

Cells - Transformed fibroblasts 17,577

Brain - Cerebellar Hemisphere 18,015

Cells - EBV-transformed lymphocytes 18,186

Esophagus - Muscularis 18,017

Artery - Tibial 17,631

Esophagus - Gastroesophageal Junction 18,000

Pituitary 18,147

Prostate 18,213

Brain - Frontal Cortex (BA9) 18,069

Spleen 17,614

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Hypothalamus 18,169

Skin - Not Sun Exposed (Suprapubic) 18,081

Adipose - Visceral (Omentum) 17,937

Skin - Sun Exposed (Lower leg) 17,968

Brain - Cortex 18,039

Esophagus - Mucosa 18,076

Small Intestine - Terminal Ileum 17,954

Brain - Spinal cord (cervical c-1) 17,973

Brain - Anterior cingulate cortex (BA24) 17,989

Adipose - Subcutaneous 18,110

Brain - Amygdala 18,006

Lung 18,057

Brain - Hippocampus 18,011

Thyroid 18,024

Brain - Caudate (basal ganglia) 18,001

Breast - Mammary Tissue 18,103

Heart - Atrial Appendage 17,896

Stomach 17,879

Brain - Substantia nigra 17,981

Muscle - Skeletal 17,778

Brain - Putamen (basal ganglia) 17,863

Minor Salivary Gland 18,005

Adrenal Gland 18,071

Testis 18,518

Kidney - Cortex 17,329

Heart - Left Ventricle 18,006

Pancreas 18,123

Colon - Transverse 17,825

Liver 18,071

Whole Blood 17,439

Fetal Brain 7,866

Adult Rectum 8,022

Adult Gallbladder 7,612

Adult Adrenal 8,475

Adult Pancreas 9,168

Adult Testis 10,836

Adult Frontal Cortex 9,048

Adult Spinal Cord 7,594

Brain

Frontal lobe

Gall bladder

Pancreas

Rectum

Spinal cord

Testis

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Brain 7,346

See source...

Synonym

Accession	Q8N8L6
Symbols	ARL10A

Gene

ARL10

Ortholog (10)

Species	Source	Disease
Opossum 12,230	Inparanoid EggNOG
Chicken 7,827	Inparanoid OMA EggNOG
Xenopus 10,468	Inparanoid OMA EggNOG
Macaque 12,761	Inparanoid OMA EggNOG
Mouse 16,570	Inparanoid OMA EggNOG
Rat 15,117	Inparanoid OMA
Dog 15,073	Inparanoid OMA EggNOG
Horse 14,252	OMA EggNOG
Cow 15,320	Inparanoid OMA EggNOG
Pig 10,168	OMA EggNOG

UniProt Keyword (4)

Complete proteome 20,231

Reference proteome 20,231

Nucleotide-binding 1,775

GTP-binding 339

GO Function (1)

GTP binding 372

GO Component (1)

intracellular 566

GO Process (1)

small GTPase mediated signal transductio... 119

Compartment GO Term (1)

cellular_component 18,320

IMPC Phenotype (3)

decreased bone mineral content 151

increased total body fat amount 134

decreased lean body mass 135

MGI Phenotype (3)

growth-size-body region phenotype 4,157

skeleton phenotype 2,222

adipose tissue phenotype 992

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

AA Sequence

MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAEAARLPEWDEWDPEDEEDEEP      1 - 70
ALEELEQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWK     71 - 140
EFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVVVVANKQDLSEAMSMGELQRELGLQAIDNQ    141 - 210
REVFLLAASIAPAGPTFEEPGTVHIWKLLLELLS                                        211 - 244
//

Text Mined References (3)

Summary
Details

	PMID	Year	Title

Tdark ADP-ribosylation factor-like protein 10 Add to cart View Collections Empty Collection