Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
gastric cancer 1.100 0.002
intraductal papillary-mucinous carcinoma... -1.300 0.025
group 3 medulloblastoma 1.500 0.003
Breast cancer -1.200 0.000
ovarian cancer -1.200 0.000

AA Sequence

MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAEAARLPEWDEWDPEDEEDEEP      1 - 70
ALEELEQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWK     71 - 140
EFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVVVVANKQDLSEAMSMGELQRELGLQAIDNQ    141 - 210
REVFLLAASIAPAGPTFEEPGTVHIWKLLLELLS                                        211 - 244
//

Text Mined References (3)

PMID Year Title
15033445 2004 RASL11A, member of a novel small monomeric GTPase gene family, is down-regulated in prostate tumors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.