Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.31
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 2.026 6.8e-03
active ulcerative colitis 1.196 4.5e-02
acute quadriplegic myopathy 1.023 1.2e-03
adult high grade glioma -1.300 1.4e-03
aldosterone-producing adenoma -1.296 1.2e-02
astrocytic glioma -2.100 1.1e-02
Breast cancer -1.300 5.2e-04
cystic fibrosis 3.126 2.8e-06
invasive ductal carcinoma -1.183 3.4e-02
juvenile dermatomyositis 1.268 2.9e-09
lung adenocarcinoma -1.400 8.3e-11
non-small cell lung cancer -1.633 2.5e-14
oligodendroglioma -1.100 6.2e-13
ovarian cancer -2.400 1.8e-06
Rheumatoid arthritis 1.200 4.2e-02
urothelial carcinoma -1.800 4.3e-02

Gene RIF (4)

AA Sequence

MCSAGELLRGGDGGERDEDGDALAEREAAGTGWDPGASPRRRGQRPKESEQDVEDSQNHTGEPVGDDYKK      1 - 70
MGTLFGELNKNLINMGFTRMYFGERIVEPVIVIFFWVMLWFLGLQALGLVAVLCLVIIYVQQ             71 - 132
//

Text Mined References (8)

PMID Year Title