Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.31
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.042
urothelial carcinoma -1.800 0.043
astrocytic glioma -2.100 0.011
oligodendroglioma -1.100 0.000
cystic fibrosis 3.126 0.000
juvenile dermatomyositis 1.268 0.000
acute quadriplegic myopathy 1.023 0.001
non-small cell lung cancer -1.633 0.000
active Crohn's disease 2.026 0.007
ulcerative colitis 1.300 0.000
adult high grade glioma -1.300 0.001
aldosterone-producing adenoma -1.296 0.012
lung adenocarcinoma -1.400 0.000
invasive ductal carcinoma -1.183 0.034
ovarian cancer -2.400 0.000
Breast cancer -1.300 0.001

Gene RIF (4)

PMID Text
23349771 Data indicate associations of SNPs in eight loci CXCR4, HHEX, FOXA2, NGN3, TCF7L2, FLJ39370 (C4orf32), LOC646279 (RPL21P7) and THADA with body mass index (BMI) and weight.
20332099 Observational study of gene-disease association. (HuGE Navigator)
19380854 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18437351 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCSAGELLRGGDGGERDEDGDALAEREAAGTGWDPGASPRRRGQRPKESEQDVEDSQNHTGEPVGDDYKK      1 - 70
MGTLFGELNKNLINMGFTRMYFGERIVEPVIVIFFWVMLWFLGLQALGLVAVLCLVIIYVQQ             71 - 132
//

Text Mined References (8)

PMID Year Title
23349771 2013 Association study of 25 type 2 diabetes related Loci with measures of obesity in Indian sib pairs.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19380854 2009 Joint effects of common genetic variants on the risk for type 2 diabetes in U.S. men and women of European ancestry.
18437351 2008 Genetic analysis of recently identified type 2 diabetes loci in 1,638 unselected patients with type 2 diabetes and 1,858 control participants from a Norwegian population-based cohort (the HUNT study).
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.