Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.40
PubTator Score 0.25

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 2.90881895087954E-8
medulloblastoma, large-cell 6234 7.01123087792619E-4
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 1.0


  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.001
ovarian cancer -1.100 0.000


Accession Q8N8J6 B7ZKW9 Q2M2Y6 Q5CZB0 Q6ZMT7 Q6ZRB3


  Ortholog (2)

Species Source
Chimp OMA EggNOG
Horse OMA Inparanoid

AA Sequence

KHTGERPYGCSDCGKAFAHLSILVKHRRIHR                                           701 - 731

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.