Property Summary

NCBI Gene PubMed Count 2
Grant Count 12
R01 Count 8
Funding $1,133,965.99
PubMed Score 27.25

Knowledge Summary

Patent

No data available

AA Sequence

MTVEQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRS      1 - 70
MSLNIGGAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGE     71 - 140
KRLREDISIMIKFWTAMFSDKKYLTASQLVPPADIGDLREQLVEENTGSLSGPAKDFYQREFDFFNKITN    141 - 210
VSAVIKPYPKGDQRKKACLSALSEVTVQPGCSLPSNPEAIVLDVDYKSGTPM                      211 - 262
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.