Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q8N8I6
Symbols C17orf55

Gene

 Compartment GO Term (0)

AA Sequence

MPRSLKRAQLRSLLPRPPAVSHTQPWYRAAHPTTSPTAASRDVHPASGAVPGPWLVEGTAVREGPQLQDA      1 - 70
VPQRPTRPSKALWPAQMSAAPAIRLGQMVPGDTRGLWGPQGTLLTWTYRGGQGGRWTRRAEGPREGTFAE     71 - 140
QRPHFQSSGAQQESRLAMGPPPLGLGDAAGDGRGQTGQEKGRAEGRQARKSACKCPRKGPNPGPWTRAAA    141 - 210
WWGRLEGAKASAKGEQVRDPGGHLWEQGHVSPCARFNQGHSCGSPKVSHTTWVS                    211 - 264
//

Text Mined References (4)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.