Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.69
PubTator Score 0.92

Knowledge Summary

Patent

No data available

Expression

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
23898208 HIV-1 Tat downregulates the expression of sterile alpha motif domain containing 12 (SAMD12) in human primary T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVEALHCGLNPRGIDHPAHAEGIKLQIEGEGVESQSIKNKNFQKVPDQKGTPKRLQAEAETAKSATVKL      1 - 70
SKPVALWTQQDVCKWLKKHCPNQYQIYSESFKQHDITGRALLRLTDKKLERMGIAQENLRQHILQQVLQL     71 - 140
KVREEVRNLQLLTQGTLLLPDGWMDGEIRRKTTLLLGQTGVRENLLLFLHRISIIENSIQI             141 - 201
//

Text Mined References (9)

PMID Year Title
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17568003 2007 Structured RNAs in the ENCODE selected regions of the human genome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.