Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.69
PubTator Score 0.92

Knowledge Summary

Patent

No data available

Expression

Gene

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
23898208 HIV-1 Tat downregulates the expression of sterile alpha motif domain containing 12 (SAMD12) in human primary T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVEALHCGLNPRGIDHPAHAEGIKLQIEGEGVESQSIKNKNFQKVPDQKGTPKRLQAEAETAKSATVKL      1 - 70
SKPVALWTQQDVCKWLKKHCPNQYQIYSESFKQHDITGRALLRLTDKKLERMGIAQENLRQHILQQVLQL     71 - 140
KVREEVRNLQLLTQGTLLLPDGWMDGEIRRKTTLLLGQTGVRENLLLFLHRISIIENSIQI             141 - 201
//

Text Mined References (9)

PMID Year Title
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17568003 2007 Structured RNAs in the ENCODE selected regions of the human genome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.