Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.69
PubTator Score 0.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 0.8
Pancreatitis 123 0.0 0.9
Disease Target Count Z-score Confidence
Early myoclonic encephalopathy 15 3.604 1.8

Expression

Gene RIF (2)

AA Sequence

MAVEALHCGLNPRGIDHPAHAEGIKLQIEGEGVESQSIKNKNFQKVPDQKGTPKRLQAEAETAKSATVKL      1 - 70
SKPVALWTQQDVCKWLKKHCPNQYQIYSESFKQHDITGRALLRLTDKKLERMGIAQENLRQHILQQVLQL     71 - 140
KVREEVRNLQLLTQGTLLLPDGWMDGEIRRKTTLLLGQTGVRENLLLFLHRISIIENSIQI             141 - 201
//

Text Mined References (9)

PMID Year Title