Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 7.5e-06
interstitial cystitis 2312 7.8e-03

AA Sequence

MMKEFSSTAQGNTEVIHTGTLQRHESHHIRDFCFQEIEKDIHNFEFQWQEEERNGHEAPMTEIKELTGST      1 - 70
DRHDQRHAGNKPIKDQLGSSFHSHLPELHIFQPEWKIGNQVEKSIINASLILTSQRISCSPKTRISNNYG     71 - 140
NNSLHSSLPIQKLGSTHERKIFPM                                                  141 - 164
//

Text Mined References (6)

PMID Year Title