Property Summary

NCBI Gene PubMed Count 10
Grant Count 10
R01 Count 5
Funding $262,641.75
PubMed Score 8.20
PubTator Score 5.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy -1.070 0.003
psoriasis -1.900 0.000

Gene RIF (3)

PMID Text
26501226 Identify novel and recurrent VGLL2-related fusions in pediatric spindle and sclerosing rhabdomyosarcomas.
14762206 VITO-1 is a crucial new cofactor of the muscle regulatory programme
12376544 role in promoting skeletal muscle differention

AA Sequence

MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGSGSSSFSSQTPASIKEEEGSP      1 - 70
EKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSSKAPRSSGPWRDCSFPMSQRS     71 - 140
FPASFWNSAYQAPVPPPLGSPLATAHSELPFAAADPYSPAALHGHLHQGATEPWHHAHPHHAHPHHPYAL    141 - 210
GGALGAQAAPYPRPAAVHEVYAPHFDPRYGPLLMPAASGRPARLATAPAPAPGSPPCELSGKGEPAGAAW    211 - 280
AGPGGPFASPSGDVAQGLGLSVDSARRYSLCGASLLS                                     281 - 317
//

Text Mined References (13)

PMID Year Title
26501226 2016 A Molecular Study of Pediatric Spindle and Sclerosing Rhabdomyosarcoma: Identification of Novel and Recurrent VGLL2-related Fusions in Infantile Cases.
25416956 2014 A proteome-scale map of the human interactome network.
22218741 2012 Genotype-phenotype correlation in interstitial 6q deletions: a report of 12 new cases.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14762206 2004 VITO-1 is an essential cofactor of TEF1-dependent muscle-specific gene regulation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14516696 2002 VITO-1, a novel vestigial related protein is predominantly expressed in the skeletal muscle lineage.
More...