Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
20417281 We report that Maf1 interacts with a novel coiled-coil domain containing protein that we have called Macoco.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378664 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEVGSEEEKWEKLDAEFDHFVVDMKPFVLKLPHRTERQRCALWIRKLCEPSGTGAGIMGRKNRNLYAKLL      1 - 70
LHMLKRGALEGPFTHRPEPGTLKILPSYMSIYFDEPNPARAKGSSPEGLPAWVLGELETSEHKLNESWKL     71 - 140
SSGEDNTLVQSPTDVYSREQYTGKLRVRSHSLSPTHREDGQNITPKICEVYSKKSPVSLDDSDIEARLNS    141 - 210
WNLGIENPRYLRQKPIPVSLMTPKFSLRKSSSFHDDHFLSRIREKELDMKTKMMEAKFHEEKLKLQQKHD    211 - 280
ADVQKILERKNNEIEELKTLYRSKQHETEETIRKLEKKVQTLIRDCQVIRETKEDQIAELKKICEQSTES    281 - 350
LNNDWEKKLHNAVAEMEQEKFDLQKQHTENIQELLEDTNVRLNKMESEYMAQTQSTNHMIKELEARVQQL    351 - 420
TGEAENSNLQRQKLIQEKAELERCYQITCSELQEVKARRNTLHKEKDHLVNDYEQNMKLLQTKYDADINL    421 - 490
LKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQENKFQMEKSHLKHIYEKKAHDLQSEL    491 - 560
DKGKEDTQKKIHKFEEALKEKEEQLTRVTEVQRLQAQQADAALEEFKRQVELNSEKVYAEMKEQMEKVEA    561 - 630
DLTRSKSLREKQSKEFLWQLEDIRQRYEQQIVELKLEHEQEKTHLLQQHNAEKDSLVRDHEREIENLEKQ    631 - 700
LRAANMEHENQIQEFKKRDAQVIADMEAQVHKLREELINVNSQRKQQLVELGLLREEEKQRATREHEIVV    701 - 770
NKLKAESEKMKIELKKTHAAETEMTLEKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQL    771 - 840
AAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETK    841 - 910
LKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGRR                             911 - 955
//

Text Mined References (16)

PMID Year Title
25115610 2014 Mutations in microRNA binding sites of CEP genes involved in cancer.
24368509 Blood methylomics in response to arsenic exposure in a low-exposed US population.
23456457 2013 CEP proteins: the knights of centrosome dynasty.
23279374 2013 Genetic determinants of plasma ??-glycoprotein I levels: a genome-wide association study in extended pedigrees from Spain.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20732626 2010 Family-based genome-wide association scan of attention-deficit/hyperactivity disorder.
20417281 2010 Identification and characterisation of a Maf1/Macoco protein complex that interacts with GABAA receptors in neurons.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378664 2010 Analysis of multiple candidate genes in association with phenotypes of multiple sclerosis.
19851299 2010 Linkage and genome-wide association analysis of obesity-related phenotypes: association of weight with the MGAT1 gene.
More...