Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.084 4.4e-03
intraductal papillary-mucinous adenoma (... 1.200 5.8e-03
medulloblastoma, large-cell -1.200 2.3e-03
non-small cell lung cancer -1.436 7.8e-19
osteosarcoma -3.514 1.3e-11

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MDSLAAGELNASHQPWVPEFVAYWRKTHQGNLQTLLLHWLLLCSCLHHLYNASCHPAFPVEYSHAVCCLQ      1 - 70
PRFWKEMSPFSSSSTTHLFSKCFFYTCLCWAWQQCSSEQNHQPCSHAAYNQVERQT                   71 - 126
//

Text Mined References (13)

PMID Year Title