Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGCCTGRCSLICLCALQLVSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPRYIMVYTVWTA      1 - 70
LWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMMDDYTYVSVTGCIV     71 - 140
DFQYLEVIHSAVQILLSLVGFVYACYVISISMEEEDTYSCDLQVCKHLFIQMLQIIE                 141 - 197
//

Text Mined References (8)

PMID Year Title
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24623842 2014 GABRA1 and STXBP1: novel genetic causes of Dravet syndrome.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23568457 2013 Genetic variants associated with disordered eating.
22437554 2012 Genome-wide association study identifies three common variants associated with serologic response to vitamin E supplementation in men.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17606467 2007 A novel family of transmembrane proteins interacting with beta subunits of the Na,K-ATPase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.