Property Summary

NCBI Gene PubMed Count 10
Grant Count 2
Funding $71,220.84
PubMed Score 26.72
PubTator Score 3.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.200 0.000

Synonym

Accession Q8N8D1 Q96AK8 Q9Y6D7
Symbols ES18
HES18

Gene

 Grant Application (2)

Gene RIF (1)

PMID Text
24416201 PDCD7, Ang2 and FIS1 may indicate a more aggressive form and poor prognosis of acute myeloid leukemia.

AA Sequence

MALPPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQPRASAEA      1 - 70
SRGGGGAGAFYPVPPPPLPPPPPQCRPFPGTDAGERPRPPPPGPGPPWSPRWPEAPPPPADVLGDAALQR     71 - 140
LRDRQWLEAVFGTPRRAGCPVPQRTHAGPSLGEVRARLLRALRLVRRLRGLSQALREAEADGAAWVLLYS    141 - 210
QTAPLRAELAERLQPLTQAAYVGEARRRLERVRRRRLRLRERAREREAEREAEAARAVEREQEIDRWRVK    211 - 280
CVQEVEEKKREQELKAAADGVLSEVRKKQADTKRMVDILRALEKLRKLRKEAAARKGVCPPASADETFTH    281 - 350
HLQRLRKLIKKRSELYEAEERALRVMLEGEQEEERKRELEKKQRKEKEKILLQKREIESKLFGDPDEFPL    351 - 420
AHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWATAVKLH         421 - 485
//

Text Mined References (11)

PMID Year Title
24416201 2014 Identification of novel molecular markers for prognosis estimation of acute myeloid leukemia: over-expression of PDCD7, FIS1 and Ang2 may indicate poor prognosis in pretreatment patients with acute myeloid leukemia.
18347052 2008 The U11-48K protein contacts the 5' splice site of U12-type introns and the U11-59K protein.
17505986 2007 Brain-derived human immunodeficiency virus-1 Tat exerts differential effects on LTR transactivation and neuroimmune activation.
16096647 2005 The U11/U12 snRNP 65K protein acts as a molecular bridge, binding the U12 snRNA and U11-59K protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10037816 1999 Characterization of a novel mouse cDNA, ES18, involved in apoptotic cell death of T-cells.
More...