Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.71
PubTator Score 1.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Mesothelioma, Malignant 105 0.0 0.0
Disease Target Count
malignant mesothelioma 3232
Disease Target Count P-value
medulloblastoma, large-cell 6241 6.1e-04

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.200 6.1e-04

AA Sequence

MALFYVARYPGPDAAAAAGPEGAEAGAHGRARALLERLQSRARERQQQREPAQTEAAASTEPATRRRRRP      1 - 70
RRRRRVNDAEPGSPEAPQGKRRKADGEDAGAESNEEAPGEPSAGSSEEAPGEPSAGSSEEAPGERSTSAS     71 - 140
AEAAPDGPALEEAAGPLVPGLVLGGFGKRKAPKVQPFLPRWLAEPNCVRRNVTEDLVPIEDIPDVHPDLQ    141 - 210
KQLRAHGISSYFPVQAAVIPALLESAACGFLVGRGGYRPSDLCVSAPTGSGKTLAFVIPVVQALLSRVVC    211 - 280
HIRALVVLPTKELAQQVSKVFNIYTDATPLRVSLVTGQKSLAKEQESLVQKTADGYRCLADIVVATPGRL    281 - 350
VDHIDQTPGFSLQQLRFLIIDEADRMIDSMHQSWLPRVVAAAFQSEDPADPCALLQRRQAQAVTAASTCC    351 - 420
PQMPLQKLLFSATLTQNPEKLQQLGLHQPRLFSTGLAHRGLEDTDGDGDSGKYAFPVGLTHHYVPCSLSS    421 - 490
KPLVVLHLVLEMGFSRVLCFTNSRENSHRLFLLVQAFGGVDVAEFSSRYGPGQRRMILKQFEQGKIQLLI    491 - 560
STDATARGIDVQGVELVVNYDAPQYLRTYVHRVGRTARAGKTGQAFTLLLKVQERRFLRMLTEAGAPELQ    561 - 630
RHELSSKLLQPLVPRYEEALSQLEESVKEERKQRAA                                      631 - 666
//

Text Mined References (21)

PMID Year Title