Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.60
PubTator Score 11.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Substance-Related Disorders 115 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
lung adenocarcinoma 2716 2.1e-18
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 1.9
Type 2 diabetes mellitus 272 0.0 1.1

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.100 2.1e-18

Protein-protein Interaction (2)

Gene RIF (12)

AA Sequence

MQKEMKMIKDEDVHFDLAVKKTPSFPHCLQPVASRGKAPQRHPFPEALRGPFSQFRYEPPPGDLDGFPGV      1 - 70
FEGAGSRKRKSMPTKMPYNHPAEEVTLALHSEENKNHGLPNLPLLFPQPPRPKYDSQMIDLCNVGFQFYR     71 - 140
SLEHFGGKPVKQEPIKPSAVWPQPTPTPFLPTPYPYYPKVHPGLMFPFFVPSSSPFPFSRHTFLPKQPPE    141 - 210
PLLPRKAEPQESEETKQKVERVDVNVQIDDSYYVDVGGSQKRWQCPTCEKSYTSKYNLVTHILGHSGIKP    211 - 280
HACTHCGKLFKQLSHLHTHMLTHQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCGRGFAYPS    281 - 350
ELKAHEAKHASGRENICVECGLDFPTLAQLKRHLTTHRGPIQYNCSECDKTFQYPSQLQNHMMKHKDIRP    351 - 420
YICSECGMEFVQPHHLKQHSLTHKGVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQCHLCYKSFVQKQ    421 - 490
TLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHMHLHSDSKPFKCLYCPSKFTLKGNLTRHMKVKHGVME    491 - 560
RGLHSQGLGRGRIALAQTAGVLRSLEQEEPFDLSQKRRAKVPVFQSDGESAQGSHCHEEEEEDNCYEVEP    561 - 630
YSPGLAPQSQQLCTPEDLSTKSEHAPEVLEEACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECL    631 - 700
SLRAFQSTRRGPSFSDYLYFKHRDESLKELLERKMEKQAVLLGI                              701 - 744
//

Text Mined References (22)

PMID Year Title