Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.51
PubTator Score 11.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.100 0.000

Gene RIF (12)

PMID Text
26170389 These data demonstrate that besides nuclear receptor regulation, DC-SCRIPT also modulates activation of NF-kappaBp65 after TLR activation in human DCs.
25663546 these data show that DC-SCRIPT acts as a novel regulator of CDKN2B and induces cell cycle arrest in ESR1-positive breast cancer cells.
23440419 DC-SCRIPT serves an important role in regulating GR function in DCs, corepressing GR-dependent upregulation of the tolerance-inducing transcription factor GILZ.
22615205 DC-SCRIPT has a primary role in the regulation of interleukin (IL)-10 production by monocytes.
22473304 DC-SCRIPT is a key regulator of androgen receptor and vitamin d receptor that play an opposite role in prostate cancer etiology and loss of DC-SCRIPT may be involved in the onset of prostate cancer.
21122099 study provides a higher level of evidence that DC-SCRIPT is indeed an independent, pure prognostic, factor for primary breast cancer and shows that DC-SCRIPT mRNA expression is most informative for either ESR1-positive and/or ESR2-low pT1 tumors
20478364 DC-SCRIPT can act as a tumor suppressor in breast cancer development.[review]
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19525478 Identification of ZNF366 and PTPRD as novel determinants of plasma homocysteine in a family-based genome-wide association study
19525478 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQKEMKMIKDEDVHFDLAVKKTPSFPHCLQPVASRGKAPQRHPFPEALRGPFSQFRYEPPPGDLDGFPGV      1 - 70
FEGAGSRKRKSMPTKMPYNHPAEEVTLALHSEENKNHGLPNLPLLFPQPPRPKYDSQMIDLCNVGFQFYR     71 - 140
SLEHFGGKPVKQEPIKPSAVWPQPTPTPFLPTPYPYYPKVHPGLMFPFFVPSSSPFPFSRHTFLPKQPPE    141 - 210
PLLPRKAEPQESEETKQKVERVDVNVQIDDSYYVDVGGSQKRWQCPTCEKSYTSKYNLVTHILGHSGIKP    211 - 280
HACTHCGKLFKQLSHLHTHMLTHQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCGRGFAYPS    281 - 350
ELKAHEAKHASGRENICVECGLDFPTLAQLKRHLTTHRGPIQYNCSECDKTFQYPSQLQNHMMKHKDIRP    351 - 420
YICSECGMEFVQPHHLKQHSLTHKGVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQCHLCYKSFVQKQ    421 - 490
TLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHMHLHSDSKPFKCLYCPSKFTLKGNLTRHMKVKHGVME    491 - 560
RGLHSQGLGRGRIALAQTAGVLRSLEQEEPFDLSQKRRAKVPVFQSDGESAQGSHCHEEEEEDNCYEVEP    561 - 630
YSPGLAPQSQQLCTPEDLSTKSEHAPEVLEEACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECL    631 - 700
SLRAFQSTRRGPSFSDYLYFKHRDESLKELLERKMEKQAVLLGI                              701 - 744
//

Text Mined References (22)

PMID Year Title
26170389 2015 DC-SCRIPT Regulates IL-10 Production in Human Dendritic Cells by Modulating NF-?Bp65 Activation.
25663546 2015 DC-SCRIPT is a novel regulator of the tumor suppressor gene CDKN2B and induces cell cycle arrest in ER?-positive breast cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
23440419 2013 DC-SCRIPT regulates glucocorticoid receptor function and expression of its target GILZ in dendritic cells.
22615205 2012 Dendritic cell-specific transcript: dendritic cell marker and regulator of TLR-induced cytokine production.
22473304 2012 DC-SCRIPT: AR and VDR regulator lost upon transformation of prostate epithelial cells.
21122099 2010 Clinical significance of the nuclear receptor co-regulator DC-SCRIPT in breast cancer: an independent retrospective validation study.
20478364 2010 Crosstalk and DC-SCRIPT: expanding nuclear receptor modulation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19525478 2009 Identification of ZNF366 and PTPRD as novel determinants of plasma homocysteine in a family-based genome-wide association study.
More...