Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8N888
Symbols BCORL2

Gene

 Compartment GO Term (0)

AA Sequence

MKEKLSKKRAEVKGNRSWLEEFLKPSDNEEGPPPKNKVLSNNASSQKPTHSSCIPLLRLPDKQQKVNESI      1 - 70
KTDMLCTDKEEECPAASLLQKYTNNSEKPSGKRQCKTKHLISQDLRQGFLLTGKCYVENADGKIPLGTCF     71 - 140
LLGLI                                                                     141 - 145
//

Text Mined References (4)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.