Property Summary

NCBI Gene PubMed Count 35
PubMed Score 350.00
PubTator Score 28.47

Knowledge Summary


No data available


  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.200 0.000
lung carcinoma -1.800 0.000
acute myeloid leukemia 1.700 0.043
ulcerative colitis 1.200 0.000
Breast cancer 1.600 0.000
head and neck cancer and chronic obstruc... 1.200 0.001
psoriasis 1.700 0.000


Accession Q8N884 L0L2J9 Q14CV6 Q32NC9 Q5SWL0 Q5SWL1 Q96E45 cGAMP synthase
Symbols cGAS



4KM5   4LEV   4LEW   4MKP   4O67   4O68   4O69  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Chicken EggNOG Inparanoid
Anole lizard OMA EggNOG
Zebrafish EggNOG Inparanoid

 GO Component (1)

Gene RIF (31)

26893169 A STING-dependent, cGAS-independent pathway important for full interferon production and antiviral control of enveloped RNA viruses.
26867174 cGAS and STING are intracellular sensors that activate the interferon pathway in response to virus infection. [review]
26819496 cGAS silencing inhibited production of proinflammatory cytokines and matrix metalloproteinases (MMPs) as well as AKT and ERK phosphorylation in TNFalpha-stimulated fibroblast-like synoviocytes
26811480 By directly binding to cGAS, LANA, and particularly, a cytoplasmic isoform, inhibit the cGAS-STING-dependent phosphorylation of TBK1 and IRF3 and thereby antagonize the cGAS-mediated restriction of KSHV lytic replication.
26506431 TRIM21-induced exposure of the viral genome promotes sensing of DNA and RNA viruses by cGAS and RIG-I
26320998 Kaposi's sarcoma-associated herpesvirus ORF52 subverts cytosolic DNA sensing by directly inhibiting cGAS enzymatic activity through a mechanism involving both cGAS binding and DNA binding.
26311870 Knockout of cGAS and STING Rescues Virus Infection of Plasmid DNA-Transfected Cells.
26199418 Gammaherpesviruses encode inhibitors that block cGAS-STING-mediated antiviral immunity.
26048138 cGAS is an innate sensor of Mycobacterium tuberculosis.Mycobacterium tuberculosis differentially activates cGAS- and inflammasome-dependent intracellular immune responses through ESX-1.
26048137 M. tuberculosis infection induces cGAS in macrophages and human lung tissue.

AA Sequence

FSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF                                          491 - 522

Text Mined References (41)

PMID Year Title
26893169 2016 Influenza A virus targets a cGAS-independent STING pathway that controls enveloped RNA viruses.
26867174 2016 The cGAS-STING Defense Pathway and Its Counteraction by Viruses.
26819496 2015 Cyclic GMP-AMP Synthase Is Required for Cell Proliferation and Inflammatory Responses in Rheumatoid Arthritis Synoviocytes.
26811480 2016 Cytoplasmic isoforms of Kaposi sarcoma herpesvirus LANA recruit and antagonize the innate immune DNA sensor cGAS.
26506431 2015 TRIM21 Promotes cGAS and RIG-I Sensing of Viral Genomes during Infection by Antibody-Opsonized Virus.
26320998 2015 Inhibition of cGAS DNA Sensing by a Herpesvirus Virion Protein.
26311870 2015 Knockout of cGAS and STING Rescues Virus Infection of Plasmid DNA-Transfected Cells.
26300263 2015 Ancient Origin of cGAS-STING Reveals Mechanism of Universal 2',3' cGAMP Signaling.
26229115 2015 Transmission of innate immune signaling by packaging of cGAMP in viral particles.
26199418 2015 Modulation of the cGAS-STING DNA sensing pathway by gammaherpesviruses.