Property Summary

NCBI Gene PubMed Count 56
PubMed Score 428.17
PubTator Score 28.47

Knowledge Summary


No data available


  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia 1.700 4.3e-02
Breast cancer 1.600 6.4e-07
glioblastoma 1.200 3.7e-05
head and neck cancer and chronic obstruc... 1.200 1.3e-03
lung carcinoma -1.800 1.5e-16
psoriasis 1.700 1.3e-86
ulcerative colitis 1.200 2.3e-05

 GO Component (1)

Gene RIF (50)

AA Sequence

FSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF                                          491 - 522

Text Mined References (64)

PMID Year Title