Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.05
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 2.5e-06
glioblastoma 1.300 2.8e-05
group 4 medulloblastoma 1.600 9.6e-05
lung cancer 1.900 8.7e-04
medulloblastoma, large-cell 1.800 9.4e-06
osteosarcoma -1.008 1.4e-02

AA Sequence

MIKTQESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKLAHGQEPWTTD      1 - 70
AKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVHLSKTHFPIVQNHDTFDLYRKNLKSS     71 - 140
LSLINQKRRHGINNPVEFIGGEKTLLHGKHERTHTKTRFSENAKCIHTKFQVFKHQRTQKIEKPHACIEC    141 - 210
EQTFLRKSQLIYHENICIQENPGSGQCEKLSRSVLFTKHLKTNTTDKICIPNEYRKGSTVKSSLITHQQT    211 - 280
HTEEKSYMCSECGKGFTMKRYLIAHQRTHSGEKPYVCKECGKGFTVKSNLIVHQRTHTGEKPYICSECGK    281 - 350
GFTMKRYLVVHQRTHTGEKPYMCSECGKGFTVKSNLIVHQRSHTGEKSYICSECGKGFTVKRTLVIHQRT    351 - 420
HTGEKSYICNECGKGFTTKRTLIIHQRTHTGEKPYECNECGKAFSQKICLIQHERCHTGKTPFVCTECGK    421 - 490
SYSHKYGLITHQRIHTGEKPYECNECGKAFTTKSVLNVHQRTHTGERPYGCSDCEKAFSHLSNLVKHKKM    491 - 560
HTREMGRISQVENSCNGESQLLPYK                                                 561 - 585
//

Text Mined References (8)

PMID Year Title