Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.05
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.48145667661727E-6
medulloblastoma, large-cell 6234 9.40088660378762E-6
glioblastoma 5572 2.7939602969511E-5
group 4 medulloblastoma 1875 9.63300125640888E-5
lung cancer 4473 8.70863170487171E-4
osteosarcoma 7933 0.0136139171654929

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.008 0.014
atypical teratoid / rhabdoid tumor 1.600 0.000
glioblastoma 1.300 0.000
group 4 medulloblastoma 1.600 0.000
medulloblastoma, large-cell 1.800 0.000
lung cancer 1.900 0.001

Synonym

Accession Q8N883 Q494T8 Q8TCF4 Q9BSN8
Symbols

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG

AA Sequence

MIKTQESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKLAHGQEPWTTD      1 - 70
AKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVHLSKTHFPIVQNHDTFDLYRKNLKSS     71 - 140
LSLINQKRRHGINNPVEFIGGEKTLLHGKHERTHTKTRFSENAKCIHTKFQVFKHQRTQKIEKPHACIEC    141 - 210
EQTFLRKSQLIYHENICIQENPGSGQCEKLSRSVLFTKHLKTNTTDKICIPNEYRKGSTVKSSLITHQQT    211 - 280
HTEEKSYMCSECGKGFTMKRYLIAHQRTHSGEKPYVCKECGKGFTVKSNLIVHQRTHTGEKPYICSECGK    281 - 350
GFTMKRYLVVHQRTHTGEKPYMCSECGKGFTVKSNLIVHQRSHTGEKSYICSECGKGFTVKRTLVIHQRT    351 - 420
HTGEKSYICNECGKGFTTKRTLIIHQRTHTGEKPYECNECGKAFSQKICLIQHERCHTGKTPFVCTECGK    421 - 490
SYSHKYGLITHQRIHTGEKPYECNECGKAFTTKSVLNVHQRTHTGERPYGCSDCEKAFSHLSNLVKHKKM    491 - 560
HTREMGRISQVENSCNGESQLLPYK                                                 561 - 585
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24280104 2014 Inhaled corticosteroid treatment modulates ZNF432 gene variant's effect on bronchodilator response in asthmatics.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.