Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.18
PubTator Score 0.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 7.16319140738565E-13
ovarian cancer 8492 1.7080020380924E-10
sonic hedgehog group medulloblastoma 1482 4.3878969558849E-6
active ulcerative colitis 477 0.00989368431123447
aldosterone-producing adenoma 664 0.0120307718240753
osteosarcoma 7933 0.0336657889647901

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.271 0.034
sonic hedgehog group medulloblastoma 2.100 0.000
active ulcerative colitis -1.889 0.010
aldosterone-producing adenoma -1.180 0.012
Breast cancer -1.400 0.000
ovarian cancer -1.400 0.000

Synonym

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG

AA Sequence

MEVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRESLQQCRLPWGAEREYGGII      1 - 70
PISLPEDHRPKYEPPRVMGKGHQHYGFGGETWPRKLPVEQFYYLTQNKKSDVYGNDSLIPKPPNSTVGEI     71 - 140
CLPYPIEHPYHTHICRGAMFPTFTSPEDLYTGIKARTQQPFPPTVPTKAYDSTVLKTRGNPYRYELIDIP    141 - 210
MDSKKKALTWPGQGVYYDFPRGVEKNKPVFYPKPPKTFAPNTSLNSWDPICSAKEANIQRNLERSHWLTS    211 - 280
YTHDFTGLGPMDPLELDDYHEKMVAELTRKIGFDPEPQEKFHPVFKPPRPLEGRIARLIQNRRSLEAIVQ    281 - 350
QRPRSCPDCTPRVLCNFHTFVPSSKEMVALSDNIPAGVTHKNQDIEEKIIEEQSLLSTYELPSCYPTKDL    351 - 420
TSIYDIKPFPKITDTKKTEDLYWRQQSLKTQPTPYCKPDHWIHYENLKSPLRDQYNMCPDPVSLSKPSVL    421 - 490
QNKQDTEAFTLEHFLSKPEEELFLNMENNEETRPVLGWIPRAGVTKPQTNLLELKNSFSKTGAQKRFHKS    491 - 560
ILEDHKDLRDNEHSGMKHQFYGHNSYYFYN                                            561 - 590
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25074808 2014 Proteomic analysis of mammalian sperm cells identifies new components of the centrosome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.