Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.18
PubTator Score 0.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3577 7.2e-13
ovarian cancer 8519 1.7e-10
medulloblastoma 720 9.6e-03
active ulcerative colitis 764 9.9e-03
aldosterone-producing adenoma 665 1.2e-02
osteosarcoma 7950 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis -1.889 9.9e-03
aldosterone-producing adenoma -1.180 1.2e-02
Breast cancer -1.400 7.2e-13
medulloblastoma 1.100 9.6e-03
osteosarcoma -1.271 3.4e-02
ovarian cancer -1.400 1.7e-10

AA Sequence

MEVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRESLQQCRLPWGAEREYGGII      1 - 70
PISLPEDHRPKYEPPRVMGKGHQHYGFGGETWPRKLPVEQFYYLTQNKKSDVYGNDSLIPKPPNSTVGEI     71 - 140
CLPYPIEHPYHTHICRGAMFPTFTSPEDLYTGIKARTQQPFPPTVPTKAYDSTVLKTRGNPYRYELIDIP    141 - 210
MDSKKKALTWPGQGVYYDFPRGVEKNKPVFYPKPPKTFAPNTSLNSWDPICSAKEANIQRNLERSHWLTS    211 - 280
YTHDFTGLGPMDPLELDDYHEKMVAELTRKIGFDPEPQEKFHPVFKPPRPLEGRIARLIQNRRSLEAIVQ    281 - 350
QRPRSCPDCTPRVLCNFHTFVPSSKEMVALSDNIPAGVTHKNQDIEEKIIEEQSLLSTYELPSCYPTKDL    351 - 420
TSIYDIKPFPKITDTKKTEDLYWRQQSLKTQPTPYCKPDHWIHYENLKSPLRDQYNMCPDPVSLSKPSVL    421 - 490
QNKQDTEAFTLEHFLSKPEEELFLNMENNEETRPVLGWIPRAGVTKPQTNLLELKNSFSKTGAQKRFHKS    491 - 560
ILEDHKDLRDNEHSGMKHQFYGHNSYYFYN                                            561 - 590
//

Text Mined References (9)

PMID Year Title