Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.26

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 8.5e-03
ependymoma 1.700 1.4e-03
Multiple myeloma -1.325 1.2e-02
oligodendroglioma 1.500 1.1e-03
osteosarcoma 1.811 4.5e-05
ovarian cancer -1.100 4.3e-03
pancreatic ductal adenocarcinoma liver m... 2.218 8.1e-04

AA Sequence

MLREEAAQKRKGKEPGMALPQGRLTFRDVAIEFSLAEWKCLNPSQRALYREVMLENYRNLEAVDISSKCM      1 - 70
MKEVLSTGQGNTEVIHTGTLQRHESHHIGDFCFQEIEKEIHDIEFQCQEDERNGLEAPMTKIKKLTGSTD     71 - 140
QHDHRHAGNKPIKDQLGSSFYSHLPELHIFQIKGEIGNQLEKSTNDAPSVSTFQRISCRPQTQISNNYGN    141 - 210
NPLNSSLLPQKQEVHMREKSFQCNKSGKAFNCSSLLRKHQIPHLGDKQYKCDVCGKLFNHEQYLACHDRC    211 - 280
HTVEKPYKCKECGKTFSQESSLTCHRRLHTGVKRYNCNECGKIFGQNSALLIDKAIDTGENPYKCNECDK    281 - 350
AFNQQSQLSHHRIHTGEKPYKCEECDKVFSRKSTIETHKRIHTGEKPYRCKVCDTAFTWHSQLARHRRIH    351 - 420
TAKKTYKCNECGKTFSHKSSLVCHHRLHGGEKSYKCKVCDKAFVWSSQLAKHTRIDCGEKPYKCNECGKT    421 - 490
FGQNSDLLIHKSIHTGEQPYKCDECEKVFSRKSSLETHKIGHTGEKPYKCKVCDKAFACHSYLAKHTRIH    491 - 560
SGEKPYKCNECSKTFSHRSYLVCHHRVHSGEKPYKCNECSKTFSRRSSLHCHRRLHSGEKPYKCNECGNT    561 - 630
FRHCSSLIYHRRLHTGEKSYKCTICDKAFVRNSLLSRHTRIHTAEKPYKCNECGKAFNQQSHLSRHHRIH    631 - 700
TGEKP                                                                     701 - 705
//

Text Mined References (7)

PMID Year Title