Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.90228158980317E-69
non-small cell lung cancer 2798 1.45456698835527E-11
posterior fossa group B ependymoma 1530 2.62945743030973E-11
Atopic dermatitis 944 5.18094773705088E-5
medulloblastoma, large-cell 6234 0.00138371250184176
interstitial cystitis 2299 0.00233852171261413
ovarian cancer 8492 0.00829376777584645
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0121956352460828

Expression

  Differential Expression (8)

Synonym

Accession Q8N816 B4DQ34 Q96BP9
Symbols

Gene

AA Sequence

MVGILPLCCSGCVPSLCCSSYVPSVAPTAAHSVRVPHSAGHCGQRVLACSLPQVFLKPWIFVEHFSSWLS      1 - 70
LELFSFLRYLGTLLCACGHRLREGLLLPCLLGVGSWLLFNNWTGGSWFSLHLQQVSLSQGSHVAAFLPEA     71 - 140
IGPGVPVPVSGESTSAQQSHAGWQLSAEADACPSVLYSEVLEWNKNINTYTSFHDFCLILGIFLFCFVLA    141 - 210
VIGLPYIKPGLSLSVALLWQSLILLSSLVQQDSQVHTWGCLFSTFTST                          211 - 258
//

Text Mined References (7)

PMID Year Title
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16461635 2006 Decoding the fine-scale structure of a breast cancer genome and transcriptome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.