Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

AA Sequence

MVGILPLCCSGCVPSLCCSSYVPSVAPTAAHSVRVPHSAGHCGQRVLACSLPQVFLKPWIFVEHFSSWLS      1 - 70
LELFSFLRYLGTLLCACGHRLREGLLLPCLLGVGSWLLFNNWTGGSWFSLHLQQVSLSQGSHVAAFLPEA     71 - 140
IGPGVPVPVSGESTSAQQSHAGWQLSAEADACPSVLYSEVLEWNKNINTYTSFHDFCLILGIFLFCFVLA    141 - 210
VIGLPYIKPGLSLSVALLWQSLILLSSLVQQDSQVHTWGCLFSTFTST                          211 - 258
//

Text Mined References (7)

PMID Year Title
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16461635 2006 Decoding the fine-scale structure of a breast cancer genome and transcriptome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.