Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Atopic dermatitis -1.300 5.2e-05
ependymoma 1.100 2.1e-10
interstitial cystitis -1.200 2.3e-03
intraductal papillary-mucinous carcinoma... -1.200 1.2e-02
medulloblastoma, large-cell 1.300 1.4e-03
non-small cell lung cancer 1.192 1.5e-11
ovarian cancer 1.100 8.3e-03
psoriasis -1.300 1.9e-69

AA Sequence

MVGILPLCCSGCVPSLCCSSYVPSVAPTAAHSVRVPHSAGHCGQRVLACSLPQVFLKPWIFVEHFSSWLS      1 - 70
LELFSFLRYLGTLLCACGHRLREGLLLPCLLGVGSWLLFNNWTGGSWFSLHLQQVSLSQGSHVAAFLPEA     71 - 140
IGPGVPVPVSGESTSAQQSHAGWQLSAEADACPSVLYSEVLEWNKNINTYTSFHDFCLILGIFLFCFVLA    141 - 210
VIGLPYIKPGLSLSVALLWQSLILLSSLVQQDSQVHTWGCLFSTFTST                          211 - 258
//

Text Mined References (7)

PMID Year Title