Property Summary

NCBI Gene PubMed Count 4
PubMed Score 5.39
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 6.8e-05
gastric carcinoma 807 1.0e-02

Expression

  Differential Expression (2)

Disease log2 FC p
gastric carcinoma -2.400 1.0e-02
medulloblastoma, large-cell 1.100 6.8e-05

AA Sequence

MDGPMRPRSASLVDFQFGVVATETIEDALLHLAQQNEQAVREASGRLGRFREPQIVEFVFLLSEQWCLEK      1 - 70
SVSYQAVEILERFMVKQAENICRQATIQPRDNKRESQNWRALKQQLVNKFTLRLVSCVQLASKLSFRNKI     71 - 140
ISNITVLNFLQALGYLHTKEELLESELDVLKSLNFRINLPTPLAYVETLLEVLGYNGCLVPAMRLHATCL    141 - 210
TLLDLVYLLHEPIYESLLRASIENSTPSQLQGEKFTSVKEDFMLLAVGIIAASAFIQNHECWSQVVGHLQ    211 - 280
SITGIALASIAEFSYAILTHGVGANTPGRQQSIPPHLAARALKTVASSNT                        281 - 330
//

Text Mined References (6)

PMID Year Title