Property Summary

NCBI Gene PubMed Count 4
Grant Count 2
R01 Count 2
Funding $62,344.9
PubMed Score 4.39
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
gastric carcinoma -2.400 0.010

AA Sequence

MDGPMRPRSASLVDFQFGVVATETIEDALLHLAQQNEQAVREASGRLGRFREPQIVEFVFLLSEQWCLEK      1 - 70
SVSYQAVEILERFMVKQAENICRQATIQPRDNKRESQNWRALKQQLVNKFTLRLVSCVQLASKLSFRNKI     71 - 140
ISNITVLNFLQALGYLHTKEELLESELDVLKSLNFRINLPTPLAYVETLLEVLGYNGCLVPAMRLHATCL    141 - 210
TLLDLVYLLHEPIYESLLRASIENSTPSQLQGEKFTSVKEDFMLLAVGIIAASAFIQNHECWSQVVGHLQ    211 - 280
SITGIALASIAEFSYAILTHGVGANTPGRQQSIPPHLAARALKTVASSNT                        281 - 330
//

Text Mined References (6)

PMID Year Title
24891606 2014 Mammalian CNTD1 is critical for meiotic crossover maturation and deselection of excess precrossover sites.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.