Knowledge Summary

Patent

No data available

Synonym

Accession Q8N814
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGWVIPEWPGAQSCPTAAQVAQPVPFMCNAPASPINDKEKDKAGGRLPSGSEPRARAFCEAGADGEQGDP      1 - 70
SPADTIKANQGHIPAAPGETGSVICWCDQSVAPPRPAGLSVSGRQSYLVGCFRWVLTFFFSVFYLTP        71 - 137
//

Text Mined References (2)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.