Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Synonym

Accession Q8N813 B2RNW5
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MGTGASEKQAEQKVRRAFEASEEAHGTLAASTPWVAMGSAYGSCTCLGAQPVTDLALWPVIYSCMGFSPQ      1 - 70
AYPAFWAYPWVLYGGYLWMGYPPPAALVPSVWLYWRGASSFDPLIGSPYLAALAPNLFPFPMKFPPTYSL     71 - 140
ASPTLGGATSSHCPQVGCWTPASSAPRAAVEGPSRGAPYLKTCKAPPSEWASRFGIWAPLPCCSSELRPL    141 - 210
PPSPIEDSQLDPGCSRSSSRSPCRARRRLFEC                                          211 - 242
//

Text Mined References (5)

PMID Year Title