Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 9.1e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

AA Sequence

MAGSHPYFNQPDSTHPSPPSAPPSLRWYQRCQPSDATSGLLVALLGGGLPAGFVGPLSRMAYQASNLPSL      1 - 70
ELLIWRCLFHLPIALLLKLRGDPLLGTPDIRSRAFFCALLNILSIGCAYSAVQVVPAGNAATVRKGSSTV     71 - 140
CSAVLTLCLESQGLSGYDWCGLLGCILGLIIIVGPGLWTLQEGTTGVYTALGYVEAFLGGLALSLRLLVY    141 - 210
RSLHFPPCLPTVAFLSGLVGLLGSVPGLFVLQAPVLPSDLLSWSCVGAVGILALVSFTCVGYAVTKAHPA    211 - 280
LVCAVLHSEVVVALILQYYMLHETVAPSDIVAAGVVLGSIAIITAQNLSCERTGRVEE                281 - 338
//

Text Mined References (4)

PMID Year Title