Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.42
PubTator Score 3.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0
Disease Target Count Z-score Confidence
Autoimmune polyendocrine syndrome type 1 9 3.827 1.9

Expression

Protein-protein Interaction (4)

Gene RIF (2)

AA Sequence

MDLLWMPLLLVAACVSAVHSSPEVNAGVSSIHITKPVHILEERSLLVLTPAGLTQMLNQTRFLMVLFHNP      1 - 70
SSKQSRNLAEELGKAVEIMGKGKNGIGFGKVDITIEKELQQEFGITKAPELKLFFEGNRSEPISCKGVVE     71 - 140
SAALVVWLRRQISQKAFLFNSSEQVAEFVISRPLVIVGFFQDLEEEVAELFYDVIKDFPELTFGVITIGN    141 - 210
VIGRFHVTLDSVLVFKKGKIVNRQKLINDSTNKQELNRVIKQHLTDFVIEYNTENKDLISELHIMSHMLL    211 - 280
FVSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNGRVFKYFRVTEVDIPSVQILNLSSDARYKMP    281 - 350
SDDITYESLKKFGRSFLSKNATKHQSSEEIPKYWDQGLVKQLVGKNFNVVVFDKEKDVFVMFYAPWSKKC    351 - 420
KMLFPLLEELGRKYQNHSTIIIAKIDVTANDIQLMYLDRYPFFRLFPSGSQQAVLYKGEHTLKGFSDFLE    421 - 490
SHIKTKIEDEDELLSVEQNEVIEEEVLAEEKEVPMMRKGLPEQQSPELENMTKYVSKLEEPAGKKKTSEE    491 - 560
VVVVVAKPKGPPVQKKKPKVKEEL                                                  561 - 584
//

Text Mined References (11)

PMID Year Title