Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.62
PubTator Score 3.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (2)

PMID Text
24662985 Further studies of this recently discovered PDI member would help to understand the important role that PDILT plays in the differentiation and maturation of spermatozoids.
15475357 The expression of PDILT, in addition to PDI in the testis, suggests that PDILT performs a specialized chaperone function in testicular cells.

AA Sequence

MDLLWMPLLLVAACVSAVHSSPEVNAGVSSIHITKPVHILEERSLLVLTPAGLTQMLNQTRFLMVLFHNP      1 - 70
SSKQSRNLAEELGKAVEIMGKGKNGIGFGKVDITIEKELQQEFGITKAPELKLFFEGNRSEPISCKGVVE     71 - 140
SAALVVWLRRQISQKAFLFNSSEQVAEFVISRPLVIVGFFQDLEEEVAELFYDVIKDFPELTFGVITIGN    141 - 210
VIGRFHVTLDSVLVFKKGKIVNRQKLINDSTNKQELNRVIKQHLTDFVIEYNTENKDLISELHIMSHMLL    211 - 280
FVSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNGRVFKYFRVTEVDIPSVQILNLSSDARYKMP    281 - 350
SDDITYESLKKFGRSFLSKNATKHQSSEEIPKYWDQGLVKQLVGKNFNVVVFDKEKDVFVMFYAPWSKKC    351 - 420
KMLFPLLEELGRKYQNHSTIIIAKIDVTANDIQLMYLDRYPFFRLFPSGSQQAVLYKGEHTLKGFSDFLE    421 - 490
SHIKTKIEDEDELLSVEQNEVIEEEVLAEEKEVPMMRKGLPEQQSPELENMTKYVSKLEEPAGKKKTSEE    491 - 560
VVVVVAKPKGPPVQKKKPKVKEEL                                                  561 - 584
//

Text Mined References (10)

PMID Year Title
24662985 2014 Structure of the substrate-binding b' domain of the Protein Disulfide Isomerase-Like protein of the Testis.
24578125 2014 Common variants in UMOD associate with urinary uromodulin levels: a meta-analysis.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
17507649 2007 A developmentally regulated chaperone complex for the endoplasmic reticulum of male haploid germ cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475357 2005 PDILT, a divergent testis-specific protein disulfide isomerase with a non-classical SXXC motif that engages in disulfide-dependent interactions in the endoplasmic reticulum.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.