Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.7e-04

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.042 3.7e-04

Gene RIF (1)

AA Sequence

MDQPAVATASTSIREDLVGGESFITASKPAQKTSSFEREGWWRIALTDTPIPGTYHLKTFIEESLLNPVI      1 - 70
ATYNFKNEGRKKPPLVQRNNPVLNDLPQYMPPDFLDLLKKQVATYSFKDKPRPSPSTLVDKDQSLQLSPG     71 - 140
QYNVLPAPVPKYASRSCVFRSTVQRFPTTYFIPHEGPGPGHYNVKMPPTSSVTSCFQSRVPRFLPSCSKT    141 - 210
PGPGAYTTLRQFPKQSPTIAKMGQEHSLFFNNNNWLLK                                    211 - 248
//

Text Mined References (5)

PMID Year Title