Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

Synonym

Accession Q8N7Y1 Q14CX1
Symbols PRR10
NCRNA00288

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEKRGESLDLGVRCKRGEERDRRPCWKPSRPGAARGGRGLWTVGGGGSPTETAESQQLGKPPEFWVSAHP      1 - 70
GWLQVSCAHRASRWDASRWHPLQRFFARRGVRRPNPSVPSPLPKPPVPSAGSCEPLAPPPTSASGASRSW     71 - 140
VTQTLAEAGAYRGCRPAPGSAAGWPRSDRRARLPRKASKPCSPALPSLAACCPQGFLRSGTKRVMCKVLG    141 - 210
PGAGVRGTAVECSEQAGVWAHCRPQLTATFS                                           211 - 241
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.