Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 8.4e-09

Expression

Synonym

Accession Q8N7Y1 Q14CX1
Symbols PRR10
NCRNA00288

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MEKRGESLDLGVRCKRGEERDRRPCWKPSRPGAARGGRGLWTVGGGGSPTETAESQQLGKPPEFWVSAHP      1 - 70
GWLQVSCAHRASRWDASRWHPLQRFFARRGVRRPNPSVPSPLPKPPVPSAGSCEPLAPPPTSASGASRSW     71 - 140
VTQTLAEAGAYRGCRPAPGSAAGWPRSDRRARLPRKASKPCSPALPSLAACCPQGFLRSGTKRVMCKVLG    141 - 210
PGAGVRGTAVECSEQAGVWAHCRPQLTATFS                                           211 - 241
//

Text Mined References (6)

PMID Year Title