Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.0

Synonym

Accession Q8N7X8
Symbols C19orf75
SIGLECP7
SIGLEC23P

Gene

  Ortholog (1)

Species Source Disease
Dog OMA EggNOG Inparanoid

AA Sequence

MLPLLQLVPAKLLNSSCSLEKTLQCSCSFHGIPTPSVQWWMGGVPVGVDGMDGSLQVTSTMLGPWANSTI      1 - 70
SLTEEPEMGMRLLCEGKNQNGTHALSILLMSRKSSLAAQAFVKGLIQGAIYAGIVIALLFLCLLPLIVKH     71 - 140
IRKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVVATFSESRILEKQDKRAS                 141 - 197
//

Text Mined References (5)

PMID Year Title