Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 9.48483679705601E-15
non-small cell lung cancer 2798 1.13740468215729E-13
breast carcinoma 1614 6.58486174883063E-7
posterior fossa group A ependymoma 1511 7.78145109686554E-7
Breast cancer 3099 1.58917702424517E-6
cystic fibrosis 1670 6.86450412814E-5
atypical teratoid/rhabdoid tumor 1095 1.42503620530899E-4
primitive neuroectodermal tumor 3031 0.0035889953638127
osteosarcoma 7933 0.0107474661543362
invasive ductal carcinoma 2950 0.0109402077174576
ductal carcinoma in situ 1745 0.040573762248376

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.461 0.011
posterior fossa group A ependymoma 1.400 0.000
cystic fibrosis 1.638 0.000
atypical teratoid/rhabdoid tumor 1.600 0.000
primitive neuroectodermal tumor 1.400 0.004
non-small cell lung cancer -1.208 0.000
breast carcinoma -1.100 0.000
lung adenocarcinoma -1.200 0.000
Breast cancer -2.400 0.000
ductal carcinoma in situ -1.400 0.041
invasive ductal carcinoma -1.900 0.011

Synonym

Accession Q8N7W2 Q5SYY7 Q5SYY8 Q5SYY9 Q8N5T7
Symbols C10orf30

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEFSERKRSRKSQSFKLVSRDYHHEVYKIPEFSNDVNGEAKETQPIFLGDESMEIKKQITGMRRLLNDST      1 - 70
GRIYQRVGKEGEKLKEEPQDLDLVWPPRLNSSAEAPQSLHPSSRGVWNELPPQSGQFSGQYGTRSRTFQS     71 - 140
QPHPTTSSNGELPVVNSSAGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQRTA    141 - 210
VSRKRNKKKKVPPKTVEPLTVKQKPSGSEMEKKSVVASELSALQAAEHTSPEESRVLGFGIVLESPSSDP    211 - 280
EVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIV    281 - 350
GAIKVFTEKYCTANHVDKLPGPRDWVQILQDQIKLARRRLKRGSEIADSDERLDGIALPPTGACGGPCTV    351 - 420
LPGGSAAVTLVLQSSPQTMSQEKGQMAEPWEEQHLVLLNNLTRDRAETGALSQTSQDFKHHSFLITQVSA    421 - 490
TLHHQRGIRNFPTPGSAKSLTLHISCLSL                                             491 - 519
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19060904 2009 An empirical framework for binary interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...