Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 3.5e-03
Breast cancer -2.400 1.6e-06
breast carcinoma -1.100 6.6e-07
cystic fibrosis 1.638 6.9e-05
ductal carcinoma in situ -1.400 4.1e-02
ependymoma 1.300 4.7e-07
invasive ductal carcinoma -1.900 1.1e-02
lung adenocarcinoma -1.200 9.5e-15
non-small cell lung cancer -1.208 1.1e-13
osteosarcoma -1.461 1.1e-02
primitive neuroectodermal tumor 1.400 3.6e-03

Gene RIF (1)

AA Sequence

MEFSERKRSRKSQSFKLVSRDYHHEVYKIPEFSNDVNGEAKETQPIFLGDESMEIKKQITGMRRLLNDST      1 - 70
GRIYQRVGKEGEKLKEEPQDLDLVWPPRLNSSAEAPQSLHPSSRGVWNELPPQSGQFSGQYGTRSRTFQS     71 - 140
QPHPTTSSNGELPVVNSSAGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQRTA    141 - 210
VSRKRNKKKKVPPKTVEPLTVKQKPSGSEMEKKSVVASELSALQAAEHTSPEESRVLGFGIVLESPSSDP    211 - 280
EVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIV    281 - 350
GAIKVFTEKYCTANHVDKLPGPRDWVQILQDQIKLARRRLKRGSEIADSDERLDGIALPPTGACGGPCTV    351 - 420
LPGGSAAVTLVLQSSPQTMSQEKGQMAEPWEEQHLVLLNNLTRDRAETGALSQTSQDFKHHSFLITQVSA    421 - 490
TLHHQRGIRNFPTPGSAKSLTLHISCLSL                                             491 - 519
//

Text Mined References (14)

PMID Year Title