Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 6.5e-05

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -1.200 6.5e-05

AA Sequence

MTSSAPTLPDVTIRNVSRHIQMSLMGKGEPPWLCRLQLEPLLQAMEEQQLGNLEARWEVEKHGNEVSGST      1 - 70
SREVWEDADFICPVLKQCTNPKLNENKNIHQAKECEKSPFLSLSPHQQWKPGLPRRNDALPTSLCLCCSE     71 - 140
N//

Text Mined References (5)

PMID Year Title