Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Breast cancer 3,094

Expression

Synonym

Accession Q8N7U9 Q495E4
Symbols C17orf54

Gene

 Compartment GO Term (0)

AA Sequence

MTSSAPTLPDVTIRNVSRHIQMSLMGKGEPPWLCRLQLEPLLQAMEEQQLGNLEARWEVEKHGNEVSGST      1 - 70
SREVWEDADFICPVLKQCTNPKLNENKNIHQAKECEKSPFLSLSPHQQWKPGLPRRNDALPTSLCLCCSE     71 - 140
N//

Text Mined References (5)

PMID Year Title
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.