Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MGAAAPAESADLGNFWKAGEPLLQGPDALAAPMSRSPSTPQTTPSPQGRQSPWPLRSLTQSHIQYFQWGR      1 - 70
PVPSTHLIEVRPTQDPAKPQRVVSEGWRRPALPGETALGRDLSCAWEGCMKGGLCRAWNPGRTWSPVTIG     71 - 140
IAPPERQESPWRSPGQRARPAGRPAAQELLDPCTRETLLGALSQCPKGSARFDGPLWFEVSDSKGGRRNL    141 - 210
QPRPSAFKPLSKNGAVASFVPRPGPLKPSLGPWSLSFCDDAWPSVLVQPAPSAIWDFWEATTPSCGSCSR    211 - 280
VSFALEVTQSAGPFGS                                                          281 - 296
//

Text Mined References (3)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.