Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.6e-10
osteosarcoma 7950 1.2e-08
medulloblastoma, large-cell 6241 4.9e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Liver cancer 604 0.0 0.5
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Testicular cancer 25 0.0 1.0

AA Sequence

MGAAAPAESADLGNFWKAGEPLLQGPDALAAPMSRSPSTPQTTPSPQGRQSPWPLRSLTQSHIQYFQWGR      1 - 70
PVPSTHLIEVRPTQDPAKPQRVVSEGWRRPALPGETALGRDLSCAWEGCMKGGLCRAWNPGRTWSPVTIG     71 - 140
IAPPERQESPWRSPGQRARPAGRPAAQELLDPCTRETLLGALSQCPKGSARFDGPLWFEVSDSKGGRRNL    141 - 210
QPRPSAFKPLSKNGAVASFVPRPGPLKPSLGPWSLSFCDDAWPSVLVQPAPSAIWDFWEATTPSCGSCSR    211 - 280
VSFALEVTQSAGPFGS                                                          281 - 296
//

Text Mined References (3)

PMID Year Title