Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.12
PubTator Score 1.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (2)

PMID Text
22851508 NANOG1-expression is positively regulated by c-JUN and beta-catenin/TCF4.
20427424 Results revealed that NANOG1 and NANOG2 protein variants are functionally equivalent and activate a regulatory circuit that activates specific stem cell genes.

AA Sequence

MDLPIQDSHDSSTSPKGKQPTTAEKSATKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQE      1 - 70
LSNILNLSYKQVKTWFQNQRMKSKRWQKNNWLKNSNGVTQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNI     71 - 140
QSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLQAALEAAGEGLNVIQQTTRY    141 - 210
FNTPQTMDLFLNYSMNMQPEDV                                                    211 - 232
//

Text Mined References (7)

PMID Year Title
24465486 2014 On the origin and evolutionary history of NANOG.
22851508 2012 Embryonic NANOG activity defines colorectal cancer stem cells and modulates through AP1- and TCF-dependent mechanisms.
20427424 2010 Transcriptional properties of human NANOG1 and NANOG2 in acute leukemic cells.
16469101 2006 Evolution of the NANOG pseudogene family in the human and chimpanzee genomes.
15233988 2004 Eleven daughters of NANOG.
15108323 2004 Identification, cloning and expression analysis of the pluripotency promoting Nanog genes in mouse and human.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.