Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.12
PubTator Score 1.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.3e-05
Disease Target Count Z-score Confidence
Velocardiofacial syndrome 46 3.398 1.7

Gene RIF (2)

AA Sequence

MDLPIQDSHDSSTSPKGKQPTTAEKSATKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQE      1 - 70
LSNILNLSYKQVKTWFQNQRMKSKRWQKNNWLKNSNGVTQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNI     71 - 140
QSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLQAALEAAGEGLNVIQQTTRY    141 - 210
FNTPQTMDLFLNYSMNMQPEDV                                                    211 - 232
//

Text Mined References (7)

PMID Year Title