Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.37
PubTator Score 0.55

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MALVFRTVAQLAGVSLSLLGWVLSCLTNYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEVGMQCKDFDSF      1 - 70
LALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLILGGILSWASGVTALVPVSWV     71 - 140
AHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLHCAACSSHAPLASGHYAVAQTQDHHQE    141 - 210
LETRNTNLKH                                                                211 - 220
//

Text Mined References (10)

PMID Year Title