Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.08
PubTator Score 5.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
20663923 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19626040 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEIRQHEWLSASPHEGFEQMRLKSRPKEPSPSLTRVGANFYSSVKQQDYSASVWLRRKDKLEHSQQKCIV      1 - 70
IFALVCCFAILVALIFSAVDIMGEDEDGLSEKNCQNKCRIALVENIPEGLNYSENAPFHLSLFQGWMNLL     71 - 140
NMAKKSVDIVSSHWDLNHTHPSACQGQRLFEKLLQLTSQNIEIKLVSDVTADSKVLEALKLKGAEVTYMN    141 - 210
MTAYNKGRLQSSFWIVDKQHVYIGSAGLDWQSLGQMKELGVIFYNCSCLVLDLQRIFALYSSLKFKSRVP    211 - 280
QTWSKRLYGVYDNEKKLQLQLNETKSQAFVSNSPKLFCPKNRSFDIDAIYSVIDDAKQYVYIAVMDYLPI    281 - 350
SSTSTKRTYWPDLDAKIREALVLRSVRVRLLLSFWKETDPLTFNFISSLKAICTEIANCSLKVKFFDLER    351 - 420
ENACATKEQKNHTFPRLNRNKYMVTDGAAYIGNFDWVGNDFTQNAGTGLVINQADVRNNRSIIKQLKDVF    421 - 490
ERDWYSPYAKTLQPTKQPNCSSLFKLKPLSNKTATDDTGGKDPRNV                            491 - 536
//

Text Mined References (12)

PMID Year Title
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20663923 2010 A genome-wide scan for common alleles affecting risk for autism.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...